VIOLIN: Vaccine Investigation and Online Information Network

Pathogen Page

Chlamydophila abortus

Fold this section

Table of Contents

General Information
Vaccine Related Pathogen Genes
1. CAB049 putative penicillin-binding protein (Protective antigen)
2. CAB613 putative peptidase (Protective antigen)
3. dnaK (Protective antigen)
4. dnaX (Protective antigen)
5. gatA (Protective antigen)
6. gatB (Protective antigen)
7. gatC (Protective antigen)
8. groEL (Protective antigen)
9. omlA (Protective antigen)
10. omp1 (Protective antigen)
11. omp2 (Protective antigen)
12. pomp90A (Protective antigen)
Vaccine Related Host Genes
1. Ighv1-9
Vaccine Information
References

Fold this section

I. General Information

1. NCBI Taxonomy ID:

2. Disease:

Abortion and fetal death

3. Introduction

Chlamydophila abortus is a species in Chlamydiae that causes abortion and fetal death in mammals, including humans. Chlamydophila abortus was previously classified as Chlamydia psittaci along with all Chlamydiae except Chlamydia trachomatis. This was based on a lack of evident glycogen production and on resistance to the antibiotic sulfadiazine. In 1999 C. psittaci and C. abortus were recognized as distinct species based on differences of pathogenicity and DNA–DNA reassociation. C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans. Infected females shed bacteria near the time of ovulation, so C. abortus is transmitted orally and sexually among mammals. All C. abortus strains were isolated or PCR-amplified from placenta or fetal organs after spontaneous abortion. C. abortus infection generally remains inapparent until an animal aborts late in gestation or gives birth to a weak or dead foetus (Wiki: Chlamydophila abortus).

4. Host Ranges and Animal Models

C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans (Wiki: Chlamydophila abortus).

II. Vaccine Related Pathogen Genes

1. CAB049 putative penicillin-binding protein

Gene Name: CAB049 putative penicillin-binding protein
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011059
NCBI Protein GI: 62184696
Other Database IDs: CDD:332066
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: penicillin-binding protein
Protein pI: 7.02
Protein Weight: 116990.97
Protein Length: 1177
Protein Note: Penicillin-binding Protein dimerisation domain; cl27245

Protein Sequence: Show Sequence

>YP_219481.1 penicillin-binding protein [Chlamydophila abortus S26/3]
MKSPKKRRSYLTVPEKTNRLLSGIIVALAIIAVRLWHLAVVEHDQKLEEAYKPQKRVIPELIERATICDR
FGKVLAENKMQYDVSVAYSAIRDLPTRAWRARADGTRELIPVRKNYIARLAQLLAQELHLDKDTIEDNIH
AKASVLGSVPYVVQANVSERTYLGLKMMMKHWPGLHVEPSVRRYYPMGKTASDILGYVGPISAQEYKSVT
HELSKLRECVRAYEEGENPKFPEGLASIDQVRSLLNSLENNAYSLNALVGKVGIEAYCDGSLRGQLGKKT
VLVDRRGNFIQGLHEVEAISGKKLQLTLSTELQAFADALLLDHEKTEQFRSAQSLKKQKFLPPLFPWIKG
GAIIALDPNNGQILAMASSPRYHNNDFIDIRDADSEARSAVYRWLENTEHIAEVYDRKVPLRRERRSSLT
GLCYDEELSLTFDYFLDFILPNTSEVKSVIQRYGTVHNAVKIQHAMERLLEVFSYSEGHCSCSSIFDAVF
PVEQEHIAIGRVISIKQQQWIARCHKAHEQEIEEIKQELEPFFAELPANYDKLLLVDLFQLVVDPSKIDP
ELLASVASFSLSEFFECQGHYVALRSAFSKIVEDIFTEVDFKEWRKLYFAKFLEVKRKEENERKQRYPTP
YVDYLVEEQRAQYQDFRRCYLDRFLAYLLSGQGDIENQKAYYEALSVWKRELENGAHQALPWYEHYEFLK
QKFSDSSIDLLRLFVSFREFLELQRPLYGNYAPMLTRNVPQKEQDLAAAFYPTYGYGYLRSHAFGQAATL
GSIFKLVSAYSVLSQEVMRGNVDVDYLSRLLVIIDRKSFGYASTKPHVGFFKDGTPIPSFYRGGILPKND
YSGRGRIDLISALEMSSNPYFSLLVGEYLSDPEDLCHAAALFGFGEKTGVGLLGEYAGAVPQDVAYNRSG
LYATAIGQHTLIVTPLQTAVMMAALVNGGTVYVPSLVLGEWDGEEFSPTPPMKKRDVFMPECITELFKSG
MHNVIWGNYGTTRSIRDQFSPELLTRIIGKTSTAESIVRVGLDRQYGSMKMKHVWFAAVGFSDEELMHPD
IVVIVYLRLGEFGRDAAPIAVKMIEKWENIRKKEKFSAMN

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding CAB049

2. CAB613 putative peptidase

Gene Name: CAB613 putative peptidase
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011061
NCBI Protein GI: 62185225
Other Database IDs: CDD:189015
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: peptidase
Protein pI: 6.33
Protein Weight: 68106.03
Protein Length: 671
Protein Note: Peptidase family M3B Oligopeptidase F (PepF); cd09608

Protein Sequence: Show Sequence

>YP_220010.1 peptidase [Chlamydophila abortus S26/3]
MSVEFNKQQVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKTDGSPTWPALQATQYQLDNSESLLSL
LTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSA
PCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHAL
ASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYT
NLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTL
KQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDA
QYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPL
TEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNS
YLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding CAB613

3. dnaK

Gene Name: dnaK
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0010882
NCBI Protein GI: 26006347
Other Database IDs: CDD:234715
Taxonomy ID: 83555
Gene Strand (Orientation): ?
Protein Name: DnaK
Protein pI: 4.71
Protein Weight: 67356.62
Protein Length: 707
Protein Note: molecular chaperone DnaK; Provisional; PRK00290

Protein Sequence: Show Sequence

>AAN77259.1 DnaK [Chlamydia abortus]
MSEQKKSSKIIGIDLGTTNSCVSVMEGGQAKVIVSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPAKT
LASTKRFIGRKYSEVESEIKTVPYQVASGSNGDVVFPIDGKQFTPEEIGAQVLIKMKETAEAYLGEPVTE
AVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKAGDKKIAVFDLGGGTFDISILEIG
DGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFQKQEGIDLSKDNMALQRLKDAAEKAKIELSGMSSTEIN
QPFITMDANGPKHLTLTLTRAHFEKLASNLIERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEV
VKSIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQK
KQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAA
SGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRREASDVRNEADSMIFRAEKAISDYKENIPESLT
KEIEERIEKVRSALKEDAPTEKIKEASDELSRHMQKIGEAMQSQSASAAANAQDGPNINTEDLKKHSFST
KPPTGNSSSSANNENIEEADVEIVDKPND

Molecule Role: Protective antigen
Molecule Role Annotation: In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
Related Vaccine(s): C. abortus DNA vaccine encoding DnaK

4. dnaX

Gene Name: dnaX
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011056
NCBI Protein GI: 62148024
Other Database IDs: CDD:180523
EnsemblGenomes-Gn:CAB327
EnsemblGenomes-Tr:CAH63776
GOA:Q5L6F0
InterPro: IPR003593
InterPro: IPR008921
InterPro: IPR012763
InterPro: IPR027417
UniProtKB/TrEMBL: Q5L6F0
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: DNA polymerase III subunit gamma/tau
Protein pI: 6.44
Protein Weight: 47941.3
Protein Length: 526
Protein Note: DNA polymerase III subunits gamma and tau; Validated

Protein Sequence: Show Sequence

>CAH63776.1 DNA polymerase III subunit gamma/tau [Chlamydia abortus S26/3]
MTSATYQVSSRKYRPQTFAEMLGQDAVVTVLKNALQFQRVAHAYLFSGIRGTGKTTLARIFAKALNCKEL
TPEHEPCNQCCVCKEISSGTSLDVIEIDGASHRGIEDIRQINETVLFTPAKSQYKIYIIDEVHMLTKEAF
NSLLKTLEEPPSHVKFFLATTENYKIPSTILSRCQKMHLKRIPETMIVDKLASISQAGGIETSREALLPI
ARAAQGSLRDAESLYDYVIGLFPTSLSPELVADALGLLSQDTLATLSECIRTQKYAEALLPVTTAINSGV
APITFLHDLTVFYRDVLLNKDQGNSPLSAIAMHYSSECLLEIIDFLGEAAKHLQQTIFEKTFLETVIIHL
IRICQRPSLETLFSQLKTSTFDTVRNVPQQQEPSKPSIQPEKHYQDQSFLTSPSPTPKVQHQKEASPSLV
GSATIDTLLQFAVVEFSGILTKE

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding DnaX

5. gatA

Gene Name: gatA
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0010879
NCBI Protein GI: 62184918
Other Database IDs: CDD:234572
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: aspartyl/glutamyl-tRNA amidotransferase subunit A
Protein pI: 6.09
Protein Weight: 50155.89
Protein Length: 593
Protein Note: aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed; PRK00012

Protein Sequence: Show Sequence

>YP_219703.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Chlamydophila abortus S26/3]
MYQKSALELRNAVVSGESSATAIAKYFYNRIKTEDNQIGAFLSLCEERAYEKAAIIDAKVARGEPLGKLA
GVPIGIKDNIHIRGLRTTCASKMLENYIAPFDATVVERIEAEDGVILGKLNMDEFAMGSTTQYSAFHPTK
NPWGLSCVPGGSSGGSAAAVSARFCPIALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFGSSLDQ
IGPLTTVVEDVALAMDVFAGKDDRDATSQKFFTGSFQEALSLDVPSLIGVPMGFLDGLRDDVKENFFASL
SILERQGSRIVEVDLNILDHAVSVYYIVASAEAATNLARFDGIRYGYRSPEAHSIEDIYTISRVQGFGKE
VMRRILLGNYVLSTERQNVYYKKGSAIRAKIIQAFQKAYEKCDVIAMPVCSCPAFADGEILDPTSLYLQD
IYTVAMNLAYLPAIAVPSGFSREGLPLGFQVIGQKGKDQQVCQVGYSFQEHSGIKNLYPKGCNKLVDGEV
K

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

Note: Part of CP #3 also belongs to gatB
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB

6. gatB

Gene Name: gatB
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0010880
NCBI Protein GI: 62147986
Other Database IDs: CDD:235489
EnsemblGenomes-Gn:CAB287
EnsemblGenomes-Tr:CAH63737
GOA:Q5L6I8
InterPro: IPR003789
InterPro: IPR004413
InterPro: IPR006075
InterPro: IPR017958
InterPro: IPR017959
InterPro: IPR018027
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: aspartyl/glutamyl-tRNA amidotransferase subunit B
Protein pI: 5.67
Protein Weight: 51934.12
Protein Length: 583
Protein Note: aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; PRK05477

Protein Sequence: Show Sequence

>CAH63737.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Chlamydia abortus S26/3]
MSDVYADWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCA
VEGEVALLSRFDRKSYFYPDSPRNFQITQFEHPIVRGGHIKAIVHGEERHFELAQAHIEDDAGMLKHFGE
FAGVDYNRAGVPLIEIVSKPCMFCADDAVAYATALVSLLDYIGISDCNMEEGSVRFDVNISVRPKGSEEL
RNKVEIKNMNSFAFMAQALEAERCRQIDAYLDNPNADPKTVIPGATYRWDPEKKKTVLMRLKERAEDYKY
FIEPDLPVLQLTEAYIDEIRHTLPELPFNKYQRYLHEYALAEDIAAILISDKHSAHFFELAAQECKNYRA
LSNWLTVEFAGRCKLKGKNLAFSGILPSSVAQLVNFIDQGVITGKIAKDIADMMMESPEKSPETILKENP
EMLPMTDESALVAIISEVITANPQSVVDYKSGKTKALGFLVGQIMKRTQGKAPPNRVNELLLVELSK

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

Note: Part of CP #3 also belongs to gatA
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB

7. gatC

Gene Name: gatC
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011057
NCBI Protein GI: 62184917
Other Database IDs: CDD:178810
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: aspartyl/glutamyl-tRNA amidotransferase subunit C
Protein pI: 4.07
Protein Weight: 10718.23
Protein Length: 196
Protein Note: aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed; PRK00034

Protein Sequence: Show Sequence

>YP_219702.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlamydophila abortus S26/3]
MTQPYVTREDIILLAKSSALELSEEFIQEYESSLNEVIKTMAASIAMDVTDVVIEVGLSHVISPEDLRED
IVASSFSREEFLTNVPESLGGLVKVPTVIK

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB, C. abortus DNA vaccine encoding GatC

8. groEL

Gene Name: groEL
Sequence Strain (Species/Organism): Chlamydophila abortus
NCBI Protein GI: AAL14265
Other Database IDs: CDD:234573
CDD:239460
Taxonomy ID: 83555
Protein Name: GroEL
Protein pI: 4.95
Protein Weight: 54453.94
Protein Length: 591
Protein Note: chaperonin GroEL; Reviewed; PRK00013

Protein Sequence: Show Sequence

>AAL14265.1 GroEL [Chlamydia abortus]
MAAKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMG
AQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDQIKKISKPVQH
HKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFTTNPET
QECVLEEALVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPG
FGDRRKAMLEDIAILTGGQLISEELGMKLENTTLSMLGKAKKVIVSKEDTTIVEGLGNKEDIEARCENIK
KQIEDSTSDYDKEKLQERLAKLSGGIAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALV
RCIPTLEAFIPVLTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVLARSSNEGYDALRDAYTDM
IEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEEKSSSVPAMPGAGMDY

Molecule Role: Protective antigen
Molecule Role Annotation: (Héchard et al., 2004)

9. omlA

Gene Name: omlA
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011060
NCBI Protein GI: 62184824
Other Database IDs: CDD:308876
Taxonomy ID: 218497
Gene Strand (Orientation): ?
Protein Name: outer membrane lipoprotein
Protein pI: 8.12
Protein Weight: 9011.35
Protein Length: 160
Protein Note: Chlamydia cysteine-rich outer membrane protein 3; pfam03503

Protein Sequence: Show Sequence

>YP_219609.1 outer membrane lipoprotein [Chlamydophila abortus S26/3]
MKKAVLLATVFCGALGLTSCCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGTYTPSCSKPCGSECNSGV
QGPQAKGCTSLDGRCKQ

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding OmlA

10. omp1

Gene Name: omp1
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0010881
NCBI Protein GI: 40601
Other Database IDs: CDD:279628
GOA:P16567
InterPro: IPR000604
UniProtKB/UniProt: P16567
Taxonomy ID: 83555
Gene Strand (Orientation): ?
Protein Name: major outer membrane protein
Protein pI: 7.65
Protein Weight: 40147.34
Protein Length: 457
Protein Note: submitted as Chlamydia psittaci;
enzootic abortion

Protein Sequence: Show Sequence

>CAA36152.1 major outer membrane protein [Chlamydia abortus]
MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCSTWCDAISIRAGYYGDYVF
DRVLKVDVNKTITGMGAVPTGTAAANYKTPTDRPNIAYGKHLQDAEWFTNAAFLALNIWDRFDIFCTLGA
SNGYFKASSAAFNLVGLIGVKGSSIAADQLPNVGITQGIVEFYTDTTFSWSVGARGALWECGCATLGAEF
QYAQSNPKIEMLNVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSATIKYHEWQVGLALSYRLNM
LVPYISVNWSRATFDADAIRIAQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIASIQINKMKSR
KACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF

Molecule Role: Protective antigen
Molecule Role Annotation: The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
Related Vaccine(s): C. abortus DNA vaccine encoding MOMP

11. omp2

Gene Name: omp2
Sequence Strain (Species/Organism): Chlamydophila abortus
NCBI Protein GI: AAD20337
Other Database IDs: CDD:281500
CDD:279661
Taxonomy ID: 83558
Protein Name: outer membrane protein 2
Protein pI: 6.33
Protein Weight: 37871.15
Protein Length: 471
Protein Note: Chlamydia cysteine-rich outer membrane protein 6; pfam03504

Protein Sequence: Show Sequence

>AAD20337.1 outer membrane protein 2, partial [Chlamydia pneumoniae]
IGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTAATVC
ACPELRSYTKCGQPAICIKQEGPDCACLRCPVCYKIEVVNTGSAIARNVTVDNPVPDGYSHASGQRVLSF
NLGDMRPGDKKVFTVEFCPQRRGQITNVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCKPVEY
SISVSNPGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQFKLVVKAQVPGRFTNQ
VAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTNDPICVGENTVYRICVTNRGSAEDTNVSLILKFSK
ELQPIASSGPTKGTISGNTVVFDALPKLGSKESVEFSVTLKGIAP

Molecule Role: Protective antigen
Molecule Role Annotation: (Bandholtz et al., 2002)

12. pomp90A

Gene Name: pomp90A
Sequence Strain (Species/Organism): Chlamydophila abortus
VO ID: VO_0011058
NCBI Protein GI: 187438939
Other Database IDs: CDD:273587
Taxonomy ID: 83555
Gene Strand (Orientation): ?
Protein Name: polymorphic outer membrane protein 90A
Protein pI: 4.63
Protein Weight: 35956.31
Protein Length: 446
Protein Note: Chlamydial polymorphic outer membrane protein repeat; TIGR01376

Protein Sequence: Show Sequence

>ACD10929.1 polymorphic outer membrane protein 90A, partial [Chlamydia abortus]
MSNSLSFANDAQTALTPSDSYNGNVTSEEFQVKETSSGTTYTCEGNVCISFAGKDSGLKKSCFSATDNLT
FLGNGYTLCFDNITTTASNPGAINVQGQGKTLGISGFSLFSCAYCPPGTTGYGAIQTKGNTTLKDNSSLV
FHKNCSTAEGGAIQCKGSSDAELKIENNQNLVFSENSSTSKGGAIYADKLTIVSGGPTLFSNNSVSNGSS
PKGGAISIKDSSGECSLTADLGDITFDGNKIIKTSGGSSTVTRNSIDLGTGKFTKLRAKDGFGIFFYDPI
TGGGSDELNINKKETVDYTGKIVFSGEKLSDEEKARAENLASTFNQPITLSAGSLVLKDGVSVTAKQVTQ
EAGSTVVMD

Molecule Role: Protective antigen
Molecule Role Annotation: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine Pomp90A

III. Vaccine Related Host Genes

1. Ighv1-9

Gene Name: Ighv1-9
Sequence Strain (Species/Organism): Mus musculus
NCBI Gene ID: 668478
Genbank Accession: AC073561
Taxonomy ID: 10090
Chromosome No: 12
Gene Starting Position: 114583568
Gene Ending Position: 114583861
Protein Name: immunoglobulin heavy variable V1-9
Protein Note: Also known as Igg2a; Gm16697

DNA Sequence: Show Sequence

>gi|372099098:114583568-114583861 Mus musculus strain C57BL/6J chromosome 12, GRCm38 C57BL/6J
GTCTTGCACAGTAATAGATGGCAGAGTCCTCAGTTGTCAGGCTGCTGAGTTGCATGTAGGCTGTGTTGGA
GGATGTATCTGCAGTGAATGTGGCCTTGCCCTTGAACTTCTCATTGTAGTTAGTACTACCACTTCCAGGT
AAAATCTCTCCAATCCACTCAAGGCCATGTCCAGGCCTCTGCTTTACCCACTCTATCCAGTAGCCAGTGA
ATGTGTAGCCAGTAGCCTTGCAGGAAAGCTTCACTGAGGCCCCAGGCTTCATCAGCTCAGCTCCAGACTG
CTGCAGCTGAACCT

Molecule Role: Vaximmutor
Related Vaccine(s): C. abortus DNA vaccine encoding DnaK, C. abortus DNA vaccine encoding MOMP

IV. Vaccine Information

1. C. abortus DNA vaccine encoding CAB049

2. C. abortus DNA vaccine encoding CAB613

3. C. abortus DNA vaccine encoding DnaK

4. C. abortus DNA vaccine encoding DnaX

5. C. abortus DNA vaccine encoding GatA/GatB

6. C. abortus DNA vaccine encoding GatC

7. C. abortus DNA vaccine encoding MOMP

8. C. abortus DNA vaccine encoding OmlA

9. C. abortus DNA vaccine Pomp90A

10. Ovilis Enzovax

V. References

1. Bandholtz et al., 2002: Bandholtz L, Kreuger MR, Svanholm C, Wigzell H, Rottenberg ME. Adjuvant modulation of the immune responses and the outcome of infection with Chlamydia pneumoniae. Clinical and experimental immunology. 2002; 130(3); 393-403. [PubMed: 12452828].

2. Chalmers et al., 1997: Chalmers WS, Simpson J, Lee SJ, Baxendale W. Use of a live chlamydial vaccine to prevent ovine enzootic abortion. The Veterinary record. 1997; 141(3); 63-67. [PubMed: 9257434].

3. HÃ©chard et al., 2002: HÃ©chard C, GrÃ©pinet O, Rodolakis A. Protection evaluation against Chlamydophila abortus challenge by DNA vaccination with a dnaK-encoding plasmid in pregnant and non-pregnant mice. Veterinary research. 2002; 33(3); 313-326. [PubMed: 12056482].

4. HÃ©chard et al., 2003: HÃ©chard C, GrÃ©pinet O, Rodolakis A. Evaluation of protection against Chlamydophila abortus challenge after DNA immunization with the major outer-membrane protein-encoding gene in pregnant and non-pregnant mice. Journal of medical microbiology. 2003; 52(Pt 1); 35-40. [PubMed: 12488563].

5. Héchard et al., 2004: Héchard C, Grépinet O, Rodolakis A. Molecular cloning of the Chlamydophila abortus groEL gene and evaluation of its protective efficacy in a murine model by genetic vaccination. Journal of medical microbiology. 2004; 53(Pt 9); 861-868. [PubMed: 15314192].

6. Stemke-Hale et al., 2005: Stemke-Hale K, Kaltenboeck B, DeGraves FJ, Sykes KF, Huang J, Bu CH, Johnston SA. Screening the whole genome of a pathogen in vivo for individual protective antigens. Vaccine. 2005; 23(23); 3016-3025. [PubMed: 15811648].

7. Wiki: Chlamydophila abortus: Chlamydophila abortus [http://en.wikipedia.org/wiki/Chlamydophila_abortus]