VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Host Responses
VaximmutorDB
VIGET
Vaxafe
Vaxar
Vaxism
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UM Logo

Chlamydophila abortus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. CAB049 putative penicillin-binding protein (Protective antigen)
    2. CAB613 putative peptidase (Protective antigen)
    3. dnaK (Protective antigen)
    4. dnaX (Protective antigen)
    5. gatA (Protective antigen)
    6. gatB (Protective antigen)
    7. gatC (Protective antigen)
    8. groEL (Protective antigen)
    9. omlA (Protective antigen)
    10. omp1 (Protective antigen)
    11. omp2 (Protective antigen)
    12. pomp90A (Protective antigen)
  3. Vaccine Related Host Genes
    1. Ighv1-9
  4. Vaccine Information
    1. C. abortus DNA vaccine encoding CAB049
    2. C. abortus DNA vaccine encoding CAB613
    3. C. abortus DNA vaccine encoding DnaK
    4. C. abortus DNA vaccine encoding DnaX
    5. C. abortus DNA vaccine encoding GatA/GatB
    6. C. abortus DNA vaccine encoding GatC
    7. C. abortus DNA vaccine encoding MOMP
    8. C. abortus DNA vaccine encoding OmlA
    9. C. abortus DNA vaccine Pomp90A
    10. Ovilis Enzovax
  5. References
I. General Information
1. NCBI Taxonomy ID:
83555
2. Disease:
Abortion and fetal death
3. Introduction
Chlamydophila abortus is a species in Chlamydiae that causes abortion and fetal death in mammals, including humans. Chlamydophila abortus was previously classified as Chlamydia psittaci along with all Chlamydiae except Chlamydia trachomatis. This was based on a lack of evident glycogen production and on resistance to the antibiotic sulfadiazine. In 1999 C. psittaci and C. abortus were recognized as distinct species based on differences of pathogenicity and DNA–DNA reassociation. C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans. Infected females shed bacteria near the time of ovulation, so C. abortus is transmitted orally and sexually among mammals. All C. abortus strains were isolated or PCR-amplified from placenta or fetal organs after spontaneous abortion. C. abortus infection generally remains inapparent until an animal aborts late in gestation or gives birth to a weak or dead foetus (Wiki: Chlamydophila abortus).
4. Host Ranges and Animal Models
C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans (Wiki: Chlamydophila abortus).
1. CAB049 putative penicillin-binding protein
  • Gene Name : CAB049 putative penicillin-binding protein
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011059
  • NCBI Protein GI : 62184696
  • Other Database IDs : CDD:332066
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : penicillin-binding protein
  • Protein pI : 7.02
  • Protein Weight : 116990.97
  • Protein Length : 1177
  • Protein Note : Penicillin-binding Protein dimerisation domain; cl27245
  • Protein Sequence : Show Sequence
    >YP_219481.1 penicillin-binding protein [Chlamydophila abortus S26/3]
    MKSPKKRRSYLTVPEKTNRLLSGIIVALAIIAVRLWHLAVVEHDQKLEEAYKPQKRVIPELIERATICDR
    FGKVLAENKMQYDVSVAYSAIRDLPTRAWRARADGTRELIPVRKNYIARLAQLLAQELHLDKDTIEDNIH
    AKASVLGSVPYVVQANVSERTYLGLKMMMKHWPGLHVEPSVRRYYPMGKTASDILGYVGPISAQEYKSVT
    HELSKLRECVRAYEEGENPKFPEGLASIDQVRSLLNSLENNAYSLNALVGKVGIEAYCDGSLRGQLGKKT
    VLVDRRGNFIQGLHEVEAISGKKLQLTLSTELQAFADALLLDHEKTEQFRSAQSLKKQKFLPPLFPWIKG
    GAIIALDPNNGQILAMASSPRYHNNDFIDIRDADSEARSAVYRWLENTEHIAEVYDRKVPLRRERRSSLT
    GLCYDEELSLTFDYFLDFILPNTSEVKSVIQRYGTVHNAVKIQHAMERLLEVFSYSEGHCSCSSIFDAVF
    PVEQEHIAIGRVISIKQQQWIARCHKAHEQEIEEIKQELEPFFAELPANYDKLLLVDLFQLVVDPSKIDP
    ELLASVASFSLSEFFECQGHYVALRSAFSKIVEDIFTEVDFKEWRKLYFAKFLEVKRKEENERKQRYPTP
    YVDYLVEEQRAQYQDFRRCYLDRFLAYLLSGQGDIENQKAYYEALSVWKRELENGAHQALPWYEHYEFLK
    QKFSDSSIDLLRLFVSFREFLELQRPLYGNYAPMLTRNVPQKEQDLAAAFYPTYGYGYLRSHAFGQAATL
    GSIFKLVSAYSVLSQEVMRGNVDVDYLSRLLVIIDRKSFGYASTKPHVGFFKDGTPIPSFYRGGILPKND
    YSGRGRIDLISALEMSSNPYFSLLVGEYLSDPEDLCHAAALFGFGEKTGVGLLGEYAGAVPQDVAYNRSG
    LYATAIGQHTLIVTPLQTAVMMAALVNGGTVYVPSLVLGEWDGEEFSPTPPMKKRDVFMPECITELFKSG
    MHNVIWGNYGTTRSIRDQFSPELLTRIIGKTSTAESIVRVGLDRQYGSMKMKHVWFAAVGFSDEELMHPD
    IVVIVYLRLGEFGRDAAPIAVKMIEKWENIRKKEKFSAMN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine encoding CAB049
2. CAB613 putative peptidase
  • Gene Name : CAB613 putative peptidase
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011061
  • NCBI Protein GI : 62185225
  • Other Database IDs : CDD:189015
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : peptidase
  • Protein pI : 6.33
  • Protein Weight : 68106.03
  • Protein Length : 671
  • Protein Note : Peptidase family M3B Oligopeptidase F (PepF); cd09608
  • Protein Sequence : Show Sequence
    >YP_220010.1 peptidase [Chlamydophila abortus S26/3]
    MSVEFNKQQVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKTDGSPTWPALQATQYQLDNSESLLSL
    LTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSA
    PCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHAL
    ASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYT
    NLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTL
    KQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDA
    QYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPL
    TEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNS
    YLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine encoding CAB613
3. dnaK
  • Gene Name : dnaK
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0010882
  • NCBI Protein GI : 26006347
  • Other Database IDs : CDD:234715
  • Taxonomy ID : 83555
  • Gene Strand (Orientation) : ?
  • Protein Name : DnaK
  • Protein pI : 4.71
  • Protein Weight : 67356.62
  • Protein Length : 707
  • Protein Note : molecular chaperone DnaK; Provisional; PRK00290
  • Protein Sequence : Show Sequence
    >AAN77259.1 DnaK [Chlamydia abortus]
    MSEQKKSSKIIGIDLGTTNSCVSVMEGGQAKVIVSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPAKT
    LASTKRFIGRKYSEVESEIKTVPYQVASGSNGDVVFPIDGKQFTPEEIGAQVLIKMKETAEAYLGEPVTE
    AVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKAGDKKIAVFDLGGGTFDISILEIG
    DGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFQKQEGIDLSKDNMALQRLKDAAEKAKIELSGMSSTEIN
    QPFITMDANGPKHLTLTLTRAHFEKLASNLIERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEV
    VKSIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQK
    KQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAA
    SGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRREASDVRNEADSMIFRAEKAISDYKENIPESLT
    KEIEERIEKVRSALKEDAPTEKIKEASDELSRHMQKIGEAMQSQSASAAANAQDGPNINTEDLKKHSFST
    KPPTGNSSSSANNENIEEADVEIVDKPND
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
  • Related Vaccine(s): C. abortus DNA vaccine encoding DnaK
4. dnaX
  • Gene Name : dnaX
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011056
  • NCBI Protein GI : 62148024
  • Other Database IDs : CDD:180523
    EnsemblGenomes-Gn:CAB327
    EnsemblGenomes-Tr:CAH63776
    GOA:Q5L6F0
    InterPro: IPR003593
    InterPro: IPR008921
    InterPro: IPR012763
    InterPro: IPR027417
    UniProtKB/TrEMBL: Q5L6F0
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : DNA polymerase III subunit gamma/tau
  • Protein pI : 6.44
  • Protein Weight : 47941.3
  • Protein Length : 526
  • Protein Note : DNA polymerase III subunits gamma and tau; Validated
  • Protein Sequence : Show Sequence
    >CAH63776.1 DNA polymerase III subunit gamma/tau [Chlamydia abortus S26/3]
    MTSATYQVSSRKYRPQTFAEMLGQDAVVTVLKNALQFQRVAHAYLFSGIRGTGKTTLARIFAKALNCKEL
    TPEHEPCNQCCVCKEISSGTSLDVIEIDGASHRGIEDIRQINETVLFTPAKSQYKIYIIDEVHMLTKEAF
    NSLLKTLEEPPSHVKFFLATTENYKIPSTILSRCQKMHLKRIPETMIVDKLASISQAGGIETSREALLPI
    ARAAQGSLRDAESLYDYVIGLFPTSLSPELVADALGLLSQDTLATLSECIRTQKYAEALLPVTTAINSGV
    APITFLHDLTVFYRDVLLNKDQGNSPLSAIAMHYSSECLLEIIDFLGEAAKHLQQTIFEKTFLETVIIHL
    IRICQRPSLETLFSQLKTSTFDTVRNVPQQQEPSKPSIQPEKHYQDQSFLTSPSPTPKVQHQKEASPSLV
    GSATIDTLLQFAVVEFSGILTKE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine encoding DnaX
5. gatA
  • Gene Name : gatA
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0010879
  • NCBI Protein GI : 62184918
  • Other Database IDs : CDD:234572
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit A
  • Protein pI : 6.09
  • Protein Weight : 50155.89
  • Protein Length : 593
  • Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed; PRK00012
  • Protein Sequence : Show Sequence
    >YP_219703.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Chlamydophila abortus S26/3]
    MYQKSALELRNAVVSGESSATAIAKYFYNRIKTEDNQIGAFLSLCEERAYEKAAIIDAKVARGEPLGKLA
    GVPIGIKDNIHIRGLRTTCASKMLENYIAPFDATVVERIEAEDGVILGKLNMDEFAMGSTTQYSAFHPTK
    NPWGLSCVPGGSSGGSAAAVSARFCPIALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFGSSLDQ
    IGPLTTVVEDVALAMDVFAGKDDRDATSQKFFTGSFQEALSLDVPSLIGVPMGFLDGLRDDVKENFFASL
    SILERQGSRIVEVDLNILDHAVSVYYIVASAEAATNLARFDGIRYGYRSPEAHSIEDIYTISRVQGFGKE
    VMRRILLGNYVLSTERQNVYYKKGSAIRAKIIQAFQKAYEKCDVIAMPVCSCPAFADGEILDPTSLYLQD
    IYTVAMNLAYLPAIAVPSGFSREGLPLGFQVIGQKGKDQQVCQVGYSFQEHSGIKNLYPKGCNKLVDGEV
    K
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

    Note: Part of CP #3 also belongs to gatB
  • Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB
6. gatB
  • Gene Name : gatB
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0010880
  • NCBI Protein GI : 62147986
  • Other Database IDs : CDD:235489
    EnsemblGenomes-Gn:CAB287
    EnsemblGenomes-Tr:CAH63737
    GOA:Q5L6I8
    InterPro: IPR003789
    InterPro: IPR004413
    InterPro: IPR006075
    InterPro: IPR017958
    InterPro: IPR017959
    InterPro: IPR018027
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit B
  • Protein pI : 5.67
  • Protein Weight : 51934.12
  • Protein Length : 583
  • Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; PRK05477
  • Protein Sequence : Show Sequence
    >CAH63737.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Chlamydia abortus S26/3]
    MSDVYADWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCA
    VEGEVALLSRFDRKSYFYPDSPRNFQITQFEHPIVRGGHIKAIVHGEERHFELAQAHIEDDAGMLKHFGE
    FAGVDYNRAGVPLIEIVSKPCMFCADDAVAYATALVSLLDYIGISDCNMEEGSVRFDVNISVRPKGSEEL
    RNKVEIKNMNSFAFMAQALEAERCRQIDAYLDNPNADPKTVIPGATYRWDPEKKKTVLMRLKERAEDYKY
    FIEPDLPVLQLTEAYIDEIRHTLPELPFNKYQRYLHEYALAEDIAAILISDKHSAHFFELAAQECKNYRA
    LSNWLTVEFAGRCKLKGKNLAFSGILPSSVAQLVNFIDQGVITGKIAKDIADMMMESPEKSPETILKENP
    EMLPMTDESALVAIISEVITANPQSVVDYKSGKTKALGFLVGQIMKRTQGKAPPNRVNELLLVELSK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

    Note: Part of CP #3 also belongs to gatA
  • Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB
7. gatC
  • Gene Name : gatC
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011057
  • NCBI Protein GI : 62184917
  • Other Database IDs : CDD:178810
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit C
  • Protein pI : 4.07
  • Protein Weight : 10718.23
  • Protein Length : 196
  • Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed; PRK00034
  • Protein Sequence : Show Sequence
    >YP_219702.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlamydophila abortus S26/3]
    MTQPYVTREDIILLAKSSALELSEEFIQEYESSLNEVIKTMAASIAMDVTDVVIEVGLSHVISPEDLRED
    IVASSFSREEFLTNVPESLGGLVKVPTVIK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB , C. abortus DNA vaccine encoding GatC
8. groEL
  • Gene Name : groEL
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • NCBI Protein GI : AAL14265
  • Other Database IDs : CDD:234573
    CDD:239460
  • Taxonomy ID : 83555
  • Protein Name : GroEL
  • Protein pI : 4.95
  • Protein Weight : 54453.94
  • Protein Length : 591
  • Protein Note : chaperonin GroEL; Reviewed; PRK00013
  • Protein Sequence : Show Sequence
    >AAL14265.1 GroEL [Chlamydia abortus]
    MAAKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMG
    AQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDQIKKISKPVQH
    HKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFTTNPET
    QECVLEEALVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPG
    FGDRRKAMLEDIAILTGGQLISEELGMKLENTTLSMLGKAKKVIVSKEDTTIVEGLGNKEDIEARCENIK
    KQIEDSTSDYDKEKLQERLAKLSGGIAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALV
    RCIPTLEAFIPVLTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVLARSSNEGYDALRDAYTDM
    IEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEEKSSSVPAMPGAGMDY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
9. omlA
  • Gene Name : omlA
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011060
  • NCBI Protein GI : 62184824
  • Other Database IDs : CDD:308876
  • Taxonomy ID : 218497
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane lipoprotein
  • Protein pI : 8.12
  • Protein Weight : 9011.35
  • Protein Length : 160
  • Protein Note : Chlamydia cysteine-rich outer membrane protein 3; pfam03503
  • Protein Sequence : Show Sequence
    >YP_219609.1 outer membrane lipoprotein [Chlamydophila abortus S26/3]
    MKKAVLLATVFCGALGLTSCCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGTYTPSCSKPCGSECNSGV
    QGPQAKGCTSLDGRCKQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine encoding OmlA
10. omp1
  • Gene Name : omp1
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0010881
  • NCBI Protein GI : 40601
  • Other Database IDs : CDD:279628
    GOA:P16567
    InterPro: IPR000604
    UniProtKB/UniProt: P16567
  • Taxonomy ID : 83555
  • Gene Strand (Orientation) : ?
  • Protein Name : major outer membrane protein
  • Protein pI : 7.65
  • Protein Weight : 40147.34
  • Protein Length : 457
  • Protein Note : submitted as Chlamydia psittaci;
    enzootic abortion
  • Protein Sequence : Show Sequence
    >CAA36152.1 major outer membrane protein [Chlamydia abortus]
    MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCSTWCDAISIRAGYYGDYVF
    DRVLKVDVNKTITGMGAVPTGTAAANYKTPTDRPNIAYGKHLQDAEWFTNAAFLALNIWDRFDIFCTLGA
    SNGYFKASSAAFNLVGLIGVKGSSIAADQLPNVGITQGIVEFYTDTTFSWSVGARGALWECGCATLGAEF
    QYAQSNPKIEMLNVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSATIKYHEWQVGLALSYRLNM
    LVPYISVNWSRATFDADAIRIAQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIASIQINKMKSR
    KACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
  • Related Vaccine(s): C. abortus DNA vaccine encoding MOMP
11. omp2
  • Gene Name : omp2
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • NCBI Protein GI : AAD20337
  • Other Database IDs : CDD:281500
    CDD:279661
  • Taxonomy ID : 83558
  • Protein Name : outer membrane protein 2
  • Protein pI : 6.33
  • Protein Weight : 37871.15
  • Protein Length : 471
  • Protein Note : Chlamydia cysteine-rich outer membrane protein 6; pfam03504
  • Protein Sequence : Show Sequence
    >AAD20337.1 outer membrane protein 2, partial [Chlamydia pneumoniae]
    IGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTAATVC
    ACPELRSYTKCGQPAICIKQEGPDCACLRCPVCYKIEVVNTGSAIARNVTVDNPVPDGYSHASGQRVLSF
    NLGDMRPGDKKVFTVEFCPQRRGQITNVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCKPVEY
    SISVSNPGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQFKLVVKAQVPGRFTNQ
    VAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTNDPICVGENTVYRICVTNRGSAEDTNVSLILKFSK
    ELQPIASSGPTKGTISGNTVVFDALPKLGSKESVEFSVTLKGIAP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Bandholtz et al., 2002)
12. pomp90A
  • Gene Name : pomp90A
  • Sequence Strain (Species/Organism) : Chlamydophila abortus
  • VO ID : VO_0011058
  • NCBI Protein GI : 187438939
  • Other Database IDs : CDD:273587
  • Taxonomy ID : 83555
  • Gene Strand (Orientation) : ?
  • Protein Name : polymorphic outer membrane protein 90A
  • Protein pI : 4.63
  • Protein Weight : 35956.31
  • Protein Length : 446
  • Protein Note : Chlamydial polymorphic outer membrane protein repeat; TIGR01376
  • Protein Sequence : Show Sequence
    >ACD10929.1 polymorphic outer membrane protein 90A, partial [Chlamydia abortus]
    MSNSLSFANDAQTALTPSDSYNGNVTSEEFQVKETSSGTTYTCEGNVCISFAGKDSGLKKSCFSATDNLT
    FLGNGYTLCFDNITTTASNPGAINVQGQGKTLGISGFSLFSCAYCPPGTTGYGAIQTKGNTTLKDNSSLV
    FHKNCSTAEGGAIQCKGSSDAELKIENNQNLVFSENSSTSKGGAIYADKLTIVSGGPTLFSNNSVSNGSS
    PKGGAISIKDSSGECSLTADLGDITFDGNKIIKTSGGSSTVTRNSIDLGTGKFTKLRAKDGFGIFFYDPI
    TGGGSDELNINKKETVDYTGKIVFSGEKLSDEEKARAENLASTFNQPITLSAGSLVLKDGVSVTAKQVTQ
    EAGSTVVMD
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).
  • Related Vaccine(s): C. abortus DNA vaccine Pomp90A
1. Ighv1-9
  • Gene Name : Ighv1-9
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 668478
  • Genbank Accession : AC073561
  • Taxonomy ID : 10090
  • Chromosome No : 12
  • Gene Starting Position : 114583568
  • Gene Ending Position : 114583861
  • Protein Name : immunoglobulin heavy variable V1-9
  • Protein Note : Also known as Igg2a; Gm16697
  • DNA Sequence : Show Sequence
    >gi|372099098:114583568-114583861 Mus musculus strain C57BL/6J chromosome 12, GRCm38 C57BL/6J
    GTCTTGCACAGTAATAGATGGCAGAGTCCTCAGTTGTCAGGCTGCTGAGTTGCATGTAGGCTGTGTTGGA
    GGATGTATCTGCAGTGAATGTGGCCTTGCCCTTGAACTTCTCATTGTAGTTAGTACTACCACTTCCAGGT
    AAAATCTCTCCAATCCACTCAAGGCCATGTCCAGGCCTCTGCTTTACCCACTCTATCCAGTAGCCAGTGA
    ATGTGTAGCCAGTAGCCTTGCAGGAAAGCTTCACTGAGGCCCCAGGCTTCATCAGCTCAGCTCCAGACTG
    CTGCAGCTGAACCT
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): C. abortus DNA vaccine encoding DnaK , C. abortus DNA vaccine encoding MOMP
IV. Vaccine Information
1. C. abortus DNA vaccine encoding CAB049
a. Vaccine Ontology ID:
VO_0011526
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus CAB049 putative penicillin-binding protein
e. Gene Engineering of CAB049 putative penicillin-binding protein
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
2. C. abortus DNA vaccine encoding CAB613
a. Vaccine Ontology ID:
VO_0011527
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus CAB613 putative peptidase
e. Gene Engineering of CAB613 putative peptidase
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).
3. C. abortus DNA vaccine encoding DnaK
a. Vaccine Ontology ID:
VO_0011518
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus molecular chaperone DnaK
e. Gene Engineering of dnaK
  • Type: DNA vaccine construction
  • Description: The dnaK gene was amplified by the polymerase chain reaction (PCR) and cloned in the appropriate vectors. PCR was performed using chlamydial genomic DNA (80 ng) as the template. The resulting fragment was inserted into the pcDNA3.1 (Invitrogen) eukaryotic vaccinal vector carrying the human cytomegalovirus immediate early-promoter and the bovine growth hormone polyadenylation signal after linearization by BamHI-XbaI double digestion to generate pcDNA3.1::DnaK. pcDNA3.1::DnaK and pcDNA3.1 control plasmid were purified after an overnight Luria Bertani (LB) culture of recombinant DH5a E. coli using the EndoFree™ (Héchard et al., 2002).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: OF1 Swiss
  • Vaccination Protocol: Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan, Rosans, France) into the tibialis anterior muscles of both ind legs. Cardiotoxin induces a local inflammation and enhances the uptake of plasmid DNA. Five days later, the mice were anesthetized by intraperitoneal injection of ketamine and xylazine (80 and 8 mg/kg of body weight, respectively) and immunized with pcDNA3.1 or pcDNA3.1::DnaK plasmids by intramuscular injections (50 mg in each tibialis anterior). The mice were boosted in the same way at days 21 and 42, mated at day 51 and challenged at day 63 by an intraperitoneal injection of 2 ´ 10^5 plaque forming units (pfu) of C. abortus AB7 (Héchard et al., 2002).
  • Challenge Protocol: Four groups of 16 non-pregnant mice were made for immunological trials. Non-pregnant mice were used in order to collect samples without affecting the pregnancy of the mice. Moreover, a good vaccine must be able to protect pregnant and non-pregnant animals. As for the mice of the abortion test, these non-pregnant mice were immunized with the 1B vaccine, pcDNA3.1 or pcDNA3.1::DnaK.One additional group was immunized by PBS (same quantity, site and time as the DNA injections) and consequently was related as the virulence control group (Héchard et al., 2002).
  • Efficacy: In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
  • Host Gene Response of Ighv1-9
    • Gene Response: In non-pregnant mice, the dnaK vaccine induced a specific humoral response with the predominant serum IgG2a isotope. No antibody response was detected in non-immunized mice or with the control plasmid. Increases in serum IgG2a were seen at day 41, increasing until day 61 with a drop on day 68 to levels similar to those seen on day 41 (Héchard et al., 2002).
    • Detailed Gene Information: Click here.
4. C. abortus DNA vaccine encoding DnaX
a. Vaccine Ontology ID:
VO_0011519
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus DNA polymerase III subunit gamma/tau antigen dnaX
e. Gene Engineering of dnaX
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).
5. C. abortus DNA vaccine encoding GatA/GatB
a. Vaccine Ontology ID:
VO_0011520
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus Glu-tRNA Gln Amidotransferase gatA and gatB
e. Gene Engineering of gatA
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Gene Engineering of gatB
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
g. Vector:
pCMVi-UB
h. Immunization Route
Intramuscular injection (i.m.)
i. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA/gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).
6. C. abortus DNA vaccine encoding GatC
a. Vaccine Ontology ID:
VO_0011428
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus aspartyl/glutamyl-tRNA amidotransferase subunit C
e. Gene Engineering of gatC
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).
7. C. abortus DNA vaccine encoding MOMP
a. Vaccine Ontology ID:
VO_0011430
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus major outer membrane protein omp1
e. Gene Engineering of omp1
  • Type: DNA vaccine construction
  • Description: The momp (omp1) gene was amplified by PCR and cloned into the vector pcDNA3.1 (Invitrogen) carrying the human cytomegalovirus immediate early promoter and the bovine growth hormone polyadenylation signal. The PCR was performed using chlamydial genomic DNA (80 ng) as template with dNTPs (200 µM each), specific primers (1 µM each) and 1 U Pfu DNA polymerase (Promega) in a Perkin Elmer 9600 thermocycler. The resulting fragment was inserted into the vector pcDNA3.1 after linearization by EcoRI/XhoI double digestion to generate pcDNA3.1 : : MOMP. The plasmid pcDNA3.1 : : MOMP and the pcDNA3.1 control plasmid were purified after an overnight Luria–Bertani culture of recombinant Escherichia coli DH5 using the EndoFree Plasmid Mega kit (Qiagen). Plasmid DNA was dissolved at 1 µg µl-1 in endotoxin-free PBS (Sigma) (Héchard et al., 2003).
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1 (Invitrogen)
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: OF1 Swiss
  • Vaccination Protocol: Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan) into the tibialis anterior muscles of both hind legs to enhance the uptake of plasmid DNA (Davis et al., 1993). Five days later, mice were anaesthetized by an intraperitoneal injection of ketamine and xylazine (respectively 80 and 8 mg kg-1 body weight) and immunized with pcDNA3.1 : : MOMP plasmid by intramuscular injections (50 µg in each tibialis anterior). Mice were boosted in the same way at days 21 and 42. The negative-control mice were immunized intramuscularly with endotoxin-free PBS (virulence control) or pcDNA3.1 plasmid. Positive-control mice were immunized with one subcutaneous injection of 4 x 10^4 p.f.u. of the live attenuated 1B vaccine at day 1 (Héchard et al., 2003).
  • Challenge Protocol: The five groups of pregnant mice were mated at day 44. Non-pregnant and pregnant mice were challenged at day 58 by an intraperitoneal injection of 4 x 10^4 p.f.u. C. abortus AB7. One group of pregnant mice neither immunized nor challenged was kept as a control for the pregnancy (gestation control) (Héchard et al., 2003).
  • Efficacy: The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
  • Host Gene Response of Ighv1-9
    • Gene Response: In non-pregnant mice, the MOMP DNA vaccine elicited a specific humoral response with predominantly serum IgG2a antibodies, suggesting a Th1-type immune response. No antibody response was detected in non-immunized mice or mice immunized with the control plasmid. The anti-MOMP IgG titre reached a maximum in the non-pregnant mice immunized with pcDNA3.1 : : MOMP after the third DNA injection (day 56) and decreased after challenge (day 63) (Héchard et al., 2003).
    • Detailed Gene Information: Click here.
8. C. abortus DNA vaccine encoding OmlA
a. Vaccine Ontology ID:
VO_0011429
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus omlA
e. Gene Engineering of omlA
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
9. C. abortus DNA vaccine Pomp90A
a. Vaccine Ontology ID:
VO_0011431
b. Type:
DNA vaccine
c. Status:
Research
d. Antigen
C. abortus polymorphic outer membrane protein 90A (pomp90A)
e. Gene Engineering of pomp90A
  • Type: DNA vaccine construction
  • Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
  • Detailed Gene Information: Click here.
f. Vector:
pCMVi-UB
g. Immunization Route
Intramuscular injection (i.m.)
h. Mouse Response
  • Host Strain: BALB/c
  • Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
  • Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
  • Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).
10. Ovilis Enzovax
a. Tradename:
Ovilis Enzovax
b. Manufacturer:
Intervet
c. Vaccine Ontology ID:
VO_0000838
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Sheep
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Live temperature-sensitive mutant strain for subcutaneous or intramuscular injection(Chalmers et al., 1997)
V. References
1. Bandholtz et al., 2002: Bandholtz L, Kreuger MR, Svanholm C, Wigzell H, Rottenberg ME. Adjuvant modulation of the immune responses and the outcome of infection with Chlamydia pneumoniae. Clinical and experimental immunology. 2002; 130(3); 393-403. [PubMed: 12452828].
2. Chalmers et al., 1997: Chalmers WS, Simpson J, Lee SJ, Baxendale W. Use of a live chlamydial vaccine to prevent ovine enzootic abortion. The Veterinary record. 1997; 141(3); 63-67. [PubMed: 9257434].
3. Héchard et al., 2002: Héchard C, Grépinet O, Rodolakis A. Protection evaluation against Chlamydophila abortus challenge by DNA vaccination with a dnaK-encoding plasmid in pregnant and non-pregnant mice. Veterinary research. 2002; 33(3); 313-326. [PubMed: 12056482].
4. Héchard et al., 2003: Héchard C, Grépinet O, Rodolakis A. Evaluation of protection against Chlamydophila abortus challenge after DNA immunization with the major outer-membrane protein-encoding gene in pregnant and non-pregnant mice. Journal of medical microbiology. 2003; 52(Pt 1); 35-40. [PubMed: 12488563].
5. Héchard et al., 2004: Héchard C, Grépinet O, Rodolakis A. Molecular cloning of the Chlamydophila abortus groEL gene and evaluation of its protective efficacy in a murine model by genetic vaccination. Journal of medical microbiology. 2004; 53(Pt 9); 861-868. [PubMed: 15314192].
6. Stemke-Hale et al., 2005: Stemke-Hale K, Kaltenboeck B, DeGraves FJ, Sykes KF, Huang J, Bu CH, Johnston SA. Screening the whole genome of a pathogen in vivo for individual protective antigens. Vaccine. 2005; 23(23); 3016-3025. [PubMed: 15811648].
7. Wiki: Chlamydophila abortus: Chlamydophila abortus [http://en.wikipedia.org/wiki/Chlamydophila_abortus]