VIOLIN: Vaccine Investigation and Online Information Network

Chlamydophila abortus

Table of Contents

General Information
Vaccine Related Pathogen Genes
1. CAB049 putative penicillin-binding protein (Protective antigen)
2. CAB613 putative peptidase (Protective antigen)
3. dnaK (Protective antigen)
4. dnaX (Protective antigen)
5. gatA (Protective antigen)
6. gatB (Protective antigen)
7. gatC (Protective antigen)
8. groEL (Protective antigen)
9. omlA (Protective antigen)
10. omp1 (Protective antigen)
11. omp2 (Protective antigen)
12. pomp90A (Protective antigen)
Vaccine Related Host Genes
1. Ighv1-9
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

2. Disease:

Abortion and fetal death

3. Introduction

Chlamydophila abortus is a species in Chlamydiae that causes abortion and fetal death in mammals, including humans. Chlamydophila abortus was previously classified as Chlamydia psittaci along with all Chlamydiae except Chlamydia trachomatis. This was based on a lack of evident glycogen production and on resistance to the antibiotic sulfadiazine. In 1999 C. psittaci and C. abortus were recognized as distinct species based on differences of pathogenicity and DNA–DNA reassociation. C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans. Infected females shed bacteria near the time of ovulation, so C. abortus is transmitted orally and sexually among mammals. All C. abortus strains were isolated or PCR-amplified from placenta or fetal organs after spontaneous abortion. C. abortus infection generally remains inapparent until an animal aborts late in gestation or gives birth to a weak or dead foetus (Wiki: Chlamydophila abortus).

4. Host Ranges and Animal Models

C. abortus is endemic among ruminants and has been associated with abortion in a horse, a rabbit, guinea pigs, mice, pigs and humans (Wiki: Chlamydophila abortus).

II. Vaccine Related Pathogen Genes

1. CAB049 putative penicillin-binding protein

Gene Name : CAB049 putative penicillin-binding protein
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011059
NCBI Protein GI : 62184696
Other Database IDs : CDD:332066
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : penicillin-binding protein
Protein pI : 7.02
Protein Weight : 116990.97
Protein Length : 1177
Protein Note : Penicillin-binding Protein dimerisation domain; cl27245

Protein Sequence : Show Sequence

>YP_219481.1 penicillin-binding protein [Chlamydophila abortus S26/3]
MKSPKKRRSYLTVPEKTNRLLSGIIVALAIIAVRLWHLAVVEHDQKLEEAYKPQKRVIPELIERATICDR
FGKVLAENKMQYDVSVAYSAIRDLPTRAWRARADGTRELIPVRKNYIARLAQLLAQELHLDKDTIEDNIH
AKASVLGSVPYVVQANVSERTYLGLKMMMKHWPGLHVEPSVRRYYPMGKTASDILGYVGPISAQEYKSVT
HELSKLRECVRAYEEGENPKFPEGLASIDQVRSLLNSLENNAYSLNALVGKVGIEAYCDGSLRGQLGKKT
VLVDRRGNFIQGLHEVEAISGKKLQLTLSTELQAFADALLLDHEKTEQFRSAQSLKKQKFLPPLFPWIKG
GAIIALDPNNGQILAMASSPRYHNNDFIDIRDADSEARSAVYRWLENTEHIAEVYDRKVPLRRERRSSLT
GLCYDEELSLTFDYFLDFILPNTSEVKSVIQRYGTVHNAVKIQHAMERLLEVFSYSEGHCSCSSIFDAVF
PVEQEHIAIGRVISIKQQQWIARCHKAHEQEIEEIKQELEPFFAELPANYDKLLLVDLFQLVVDPSKIDP
ELLASVASFSLSEFFECQGHYVALRSAFSKIVEDIFTEVDFKEWRKLYFAKFLEVKRKEENERKQRYPTP
YVDYLVEEQRAQYQDFRRCYLDRFLAYLLSGQGDIENQKAYYEALSVWKRELENGAHQALPWYEHYEFLK
QKFSDSSIDLLRLFVSFREFLELQRPLYGNYAPMLTRNVPQKEQDLAAAFYPTYGYGYLRSHAFGQAATL
GSIFKLVSAYSVLSQEVMRGNVDVDYLSRLLVIIDRKSFGYASTKPHVGFFKDGTPIPSFYRGGILPKND
YSGRGRIDLISALEMSSNPYFSLLVGEYLSDPEDLCHAAALFGFGEKTGVGLLGEYAGAVPQDVAYNRSG
LYATAIGQHTLIVTPLQTAVMMAALVNGGTVYVPSLVLGEWDGEEFSPTPPMKKRDVFMPECITELFKSG
MHNVIWGNYGTTRSIRDQFSPELLTRIIGKTSTAESIVRVGLDRQYGSMKMKHVWFAAVGFSDEELMHPD
IVVIVYLRLGEFGRDAAPIAVKMIEKWENIRKKEKFSAMN

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding CAB049

2. CAB613 putative peptidase

Gene Name : CAB613 putative peptidase
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011061
NCBI Protein GI : 62185225
Other Database IDs : CDD:189015
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : peptidase
Protein pI : 6.33
Protein Weight : 68106.03
Protein Length : 671
Protein Note : Peptidase family M3B Oligopeptidase F (PepF); cd09608

Protein Sequence : Show Sequence

>YP_220010.1 peptidase [Chlamydophila abortus S26/3]
MSVEFNKQQVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKTDGSPTWPALQATQYQLDNSESLLSL
LTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSA
PCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHAL
ASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYT
NLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTL
KQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDA
QYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPL
TEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNS
YLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding CAB613

3. dnaK

Gene Name : dnaK
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0010882
NCBI Protein GI : 26006347
Other Database IDs : CDD:234715
Taxonomy ID : 83555
Gene Strand (Orientation) : ?
Protein Name : DnaK
Protein pI : 4.71
Protein Weight : 67356.62
Protein Length : 707
Protein Note : molecular chaperone DnaK; Provisional; PRK00290

Protein Sequence : Show Sequence

>AAN77259.1 DnaK [Chlamydia abortus]
MSEQKKSSKIIGIDLGTTNSCVSVMEGGQAKVIVSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPAKT
LASTKRFIGRKYSEVESEIKTVPYQVASGSNGDVVFPIDGKQFTPEEIGAQVLIKMKETAEAYLGEPVTE
AVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKAGDKKIAVFDLGGGTFDISILEIG
DGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFQKQEGIDLSKDNMALQRLKDAAEKAKIELSGMSSTEIN
QPFITMDANGPKHLTLTLTRAHFEKLASNLIERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEV
VKSIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQK
KQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAA
SGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRREASDVRNEADSMIFRAEKAISDYKENIPESLT
KEIEERIEKVRSALKEDAPTEKIKEASDELSRHMQKIGEAMQSQSASAAANAQDGPNINTEDLKKHSFST
KPPTGNSSSSANNENIEEADVEIVDKPND

Molecule Role : Protective antigen
Molecule Role Annotation : In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
Related Vaccine(s): C. abortus DNA vaccine encoding DnaK

4. dnaX

Gene Name : dnaX
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011056
NCBI Protein GI : 62148024
Other Database IDs : CDD:180523
EnsemblGenomes-Gn:CAB327
EnsemblGenomes-Tr:CAH63776
GOA:Q5L6F0
InterPro: IPR003593
InterPro: IPR008921
InterPro: IPR012763
InterPro: IPR027417
UniProtKB/TrEMBL: Q5L6F0
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : DNA polymerase III subunit gamma/tau
Protein pI : 6.44
Protein Weight : 47941.3
Protein Length : 526
Protein Note : DNA polymerase III subunits gamma and tau; Validated

Protein Sequence : Show Sequence

>CAH63776.1 DNA polymerase III subunit gamma/tau [Chlamydia abortus S26/3]
MTSATYQVSSRKYRPQTFAEMLGQDAVVTVLKNALQFQRVAHAYLFSGIRGTGKTTLARIFAKALNCKEL
TPEHEPCNQCCVCKEISSGTSLDVIEIDGASHRGIEDIRQINETVLFTPAKSQYKIYIIDEVHMLTKEAF
NSLLKTLEEPPSHVKFFLATTENYKIPSTILSRCQKMHLKRIPETMIVDKLASISQAGGIETSREALLPI
ARAAQGSLRDAESLYDYVIGLFPTSLSPELVADALGLLSQDTLATLSECIRTQKYAEALLPVTTAINSGV
APITFLHDLTVFYRDVLLNKDQGNSPLSAIAMHYSSECLLEIIDFLGEAAKHLQQTIFEKTFLETVIIHL
IRICQRPSLETLFSQLKTSTFDTVRNVPQQQEPSKPSIQPEKHYQDQSFLTSPSPTPKVQHQKEASPSLV
GSATIDTLLQFAVVEFSGILTKE

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding DnaX

5. gatA

Gene Name : gatA
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0010879
NCBI Protein GI : 62184918
Other Database IDs : CDD:234572
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit A
Protein pI : 6.09
Protein Weight : 50155.89
Protein Length : 593
Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed; PRK00012

Protein Sequence : Show Sequence

>YP_219703.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Chlamydophila abortus S26/3]
MYQKSALELRNAVVSGESSATAIAKYFYNRIKTEDNQIGAFLSLCEERAYEKAAIIDAKVARGEPLGKLA
GVPIGIKDNIHIRGLRTTCASKMLENYIAPFDATVVERIEAEDGVILGKLNMDEFAMGSTTQYSAFHPTK
NPWGLSCVPGGSSGGSAAAVSARFCPIALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYGLVAFGSSLDQ
IGPLTTVVEDVALAMDVFAGKDDRDATSQKFFTGSFQEALSLDVPSLIGVPMGFLDGLRDDVKENFFASL
SILERQGSRIVEVDLNILDHAVSVYYIVASAEAATNLARFDGIRYGYRSPEAHSIEDIYTISRVQGFGKE
VMRRILLGNYVLSTERQNVYYKKGSAIRAKIIQAFQKAYEKCDVIAMPVCSCPAFADGEILDPTSLYLQD
IYTVAMNLAYLPAIAVPSGFSREGLPLGFQVIGQKGKDQQVCQVGYSFQEHSGIKNLYPKGCNKLVDGEV
K

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

Note: Part of CP #3 also belongs to gatB
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB

6. gatB

Gene Name : gatB
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0010880
NCBI Protein GI : 62147986
Other Database IDs : CDD:235489
EnsemblGenomes-Gn:CAB287
EnsemblGenomes-Tr:CAH63737
GOA:Q5L6I8
InterPro: IPR003789
InterPro: IPR004413
InterPro: IPR006075
InterPro: IPR017958
InterPro: IPR017959
InterPro: IPR018027
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit B
Protein pI : 5.67
Protein Weight : 51934.12
Protein Length : 583
Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; PRK05477

Protein Sequence : Show Sequence

>CAH63737.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Chlamydia abortus S26/3]
MSDVYADWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCA
VEGEVALLSRFDRKSYFYPDSPRNFQITQFEHPIVRGGHIKAIVHGEERHFELAQAHIEDDAGMLKHFGE
FAGVDYNRAGVPLIEIVSKPCMFCADDAVAYATALVSLLDYIGISDCNMEEGSVRFDVNISVRPKGSEEL
RNKVEIKNMNSFAFMAQALEAERCRQIDAYLDNPNADPKTVIPGATYRWDPEKKKTVLMRLKERAEDYKY
FIEPDLPVLQLTEAYIDEIRHTLPELPFNKYQRYLHEYALAEDIAAILISDKHSAHFFELAAQECKNYRA
LSNWLTVEFAGRCKLKGKNLAFSGILPSSVAQLVNFIDQGVITGKIAKDIADMMMESPEKSPETILKENP
EMLPMTDESALVAIISEVITANPQSVVDYKSGKTKALGFLVGQIMKRTQGKAPPNRVNELLLVELSK

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

Note: Part of CP #3 also belongs to gatA
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB

7. gatC

Gene Name : gatC
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011057
NCBI Protein GI : 62184917
Other Database IDs : CDD:178810
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : aspartyl/glutamyl-tRNA amidotransferase subunit C
Protein pI : 4.07
Protein Weight : 10718.23
Protein Length : 196
Protein Note : aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed; PRK00034

Protein Sequence : Show Sequence

>YP_219702.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlamydophila abortus S26/3]
MTQPYVTREDIILLAKSSALELSEEFIQEYESSLNEVIKTMAASIAMDVTDVVIEVGLSHVISPEDLRED
IVASSFSREEFLTNVPESLGGLVKVPTVIK

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding GatA/GatB , C. abortus DNA vaccine encoding GatC

8. groEL

Gene Name : groEL
Sequence Strain (Species/Organism) : Chlamydophila abortus
NCBI Protein GI : AAL14265
Other Database IDs : CDD:234573
CDD:239460
Taxonomy ID : 83555
Protein Name : GroEL
Protein pI : 4.95
Protein Weight : 54453.94
Protein Length : 591
Protein Note : chaperonin GroEL; Reviewed; PRK00013

Protein Sequence : Show Sequence

>AAL14265.1 GroEL [Chlamydia abortus]
MAAKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMG
AQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDQIKKISKPVQH
HKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFTTNPET
QECVLEEALVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPG
FGDRRKAMLEDIAILTGGQLISEELGMKLENTTLSMLGKAKKVIVSKEDTTIVEGLGNKEDIEARCENIK
KQIEDSTSDYDKEKLQERLAKLSGGIAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALV
RCIPTLEAFIPVLTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVLARSSNEGYDALRDAYTDM
IEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEEKSSSVPAMPGAGMDY

Molecule Role : Protective antigen
Molecule Role Annotation :

9. omlA

Gene Name : omlA
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011060
NCBI Protein GI : 62184824
Other Database IDs : CDD:308876
Taxonomy ID : 218497
Gene Strand (Orientation) : ?
Protein Name : outer membrane lipoprotein
Protein pI : 8.12
Protein Weight : 9011.35
Protein Length : 160
Protein Note : Chlamydia cysteine-rich outer membrane protein 3; pfam03503

Protein Sequence : Show Sequence

>YP_219609.1 outer membrane lipoprotein [Chlamydophila abortus S26/3]
MKKAVLLATVFCGALGLTSCCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGTYTPSCSKPCGSECNSGV
QGPQAKGCTSLDGRCKQ

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine encoding OmlA

10. omp1

Gene Name : omp1
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0010881
NCBI Protein GI : 40601
Other Database IDs : CDD:279628
GOA:P16567
InterPro: IPR000604
UniProtKB/UniProt: P16567
Taxonomy ID : 83555
Gene Strand (Orientation) : ?
Protein Name : major outer membrane protein
Protein pI : 7.65
Protein Weight : 40147.34
Protein Length : 457
Protein Note : submitted as Chlamydia psittaci;
enzootic abortion

Protein Sequence : Show Sequence

>CAA36152.1 major outer membrane protein [Chlamydia abortus]
MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCSTWCDAISIRAGYYGDYVF
DRVLKVDVNKTITGMGAVPTGTAAANYKTPTDRPNIAYGKHLQDAEWFTNAAFLALNIWDRFDIFCTLGA
SNGYFKASSAAFNLVGLIGVKGSSIAADQLPNVGITQGIVEFYTDTTFSWSVGARGALWECGCATLGAEF
QYAQSNPKIEMLNVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSATIKYHEWQVGLALSYRLNM
LVPYISVNWSRATFDADAIRIAQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIASIQINKMKSR
KACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF

Molecule Role : Protective antigen
Molecule Role Annotation : The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
Related Vaccine(s): C. abortus DNA vaccine encoding MOMP

11. omp2

Gene Name : omp2
Sequence Strain (Species/Organism) : Chlamydophila abortus
NCBI Protein GI : AAD20337
Other Database IDs : CDD:281500
CDD:279661
Taxonomy ID : 83558
Protein Name : outer membrane protein 2
Protein pI : 6.33
Protein Weight : 37871.15
Protein Length : 471
Protein Note : Chlamydia cysteine-rich outer membrane protein 6; pfam03504

Protein Sequence : Show Sequence

>AAD20337.1 outer membrane protein 2, partial [Chlamydia pneumoniae]
IGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTAATVC
ACPELRSYTKCGQPAICIKQEGPDCACLRCPVCYKIEVVNTGSAIARNVTVDNPVPDGYSHASGQRVLSF
NLGDMRPGDKKVFTVEFCPQRRGQITNVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCKPVEY
SISVSNPGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQFKLVVKAQVPGRFTNQ
VAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTNDPICVGENTVYRICVTNRGSAEDTNVSLILKFSK
ELQPIASSGPTKGTISGNTVVFDALPKLGSKESVEFSVTLKGIAP

Molecule Role : Protective antigen
Molecule Role Annotation : (Bandholtz et al., 2002)

12. pomp90A

Gene Name : pomp90A
Sequence Strain (Species/Organism) : Chlamydophila abortus
VO ID : VO_0011058
NCBI Protein GI : 187438939
Other Database IDs : CDD:273587
Taxonomy ID : 83555
Gene Strand (Orientation) : ?
Protein Name : polymorphic outer membrane protein 90A
Protein pI : 4.63
Protein Weight : 35956.31
Protein Length : 446
Protein Note : Chlamydial polymorphic outer membrane protein repeat; TIGR01376

Protein Sequence : Show Sequence

>ACD10929.1 polymorphic outer membrane protein 90A, partial [Chlamydia abortus]
MSNSLSFANDAQTALTPSDSYNGNVTSEEFQVKETSSGTTYTCEGNVCISFAGKDSGLKKSCFSATDNLT
FLGNGYTLCFDNITTTASNPGAINVQGQGKTLGISGFSLFSCAYCPPGTTGYGAIQTKGNTTLKDNSSLV
FHKNCSTAEGGAIQCKGSSDAELKIENNQNLVFSENSSTSKGGAIYADKLTIVSGGPTLFSNNSVSNGSS
PKGGAISIKDSSGECSLTADLGDITFDGNKIIKTSGGSSTVTRNSIDLGTGKFTKLRAKDGFGIFFYDPI
TGGGSDELNINKKETVDYTGKIVFSGEKLSDEEKARAENLASTFNQPITLSAGSLVLKDGVSVTAKQVTQ
EAGSTVVMD

Molecule Role : Protective antigen
Molecule Role Annotation : Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).
Related Vaccine(s): C. abortus DNA vaccine Pomp90A

III. Vaccine Related Host Genes

1. Ighv1-9

Gene Name : Ighv1-9
Sequence Strain (Species/Organism) : Mus musculus
NCBI Gene ID : 668478
Genbank Accession : AC073561
Taxonomy ID : 10090
Chromosome No : 12
Gene Starting Position : 114583568
Gene Ending Position : 114583861
Protein Name : immunoglobulin heavy variable V1-9
Protein Note : Also known as Igg2a; Gm16697

DNA Sequence : Show Sequence

>gi|372099098:114583568-114583861 Mus musculus strain C57BL/6J chromosome 12, GRCm38 C57BL/6J
GTCTTGCACAGTAATAGATGGCAGAGTCCTCAGTTGTCAGGCTGCTGAGTTGCATGTAGGCTGTGTTGGA
GGATGTATCTGCAGTGAATGTGGCCTTGCCCTTGAACTTCTCATTGTAGTTAGTACTACCACTTCCAGGT
AAAATCTCTCCAATCCACTCAAGGCCATGTCCAGGCCTCTGCTTTACCCACTCTATCCAGTAGCCAGTGA
ATGTGTAGCCAGTAGCCTTGCAGGAAAGCTTCACTGAGGCCCCAGGCTTCATCAGCTCAGCTCCAGACTG
CTGCAGCTGAACCT

Molecule Role : Vaximmutor
Related Vaccine(s): C. abortus DNA vaccine encoding DnaK , C. abortus DNA vaccine encoding MOMP

IV. Vaccine Information

1. C. abortus DNA vaccine encoding CAB049

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus CAB049 putative penicillin-binding protein

e. Gene Engineering of CAB049 putative penicillin-binding protein

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #5 (Transglycolase/transpeptidase, CAB049 putative penicillin-binding protein) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).

2. C. abortus DNA vaccine encoding CAB613

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus CAB613 putative peptidase

e. Gene Engineering of CAB613 putative peptidase

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).

3. C. abortus DNA vaccine encoding DnaK

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus molecular chaperone DnaK

e. Gene Engineering of dnaK

Type: DNA vaccine construction
Description: The dnaK gene was amplified by the polymerase chain reaction (PCR) and cloned in the appropriate vectors. PCR was performed using chlamydial genomic DNA (80 ng) as the template. The resulting fragment was inserted into the pcDNA3.1 (Invitrogen) eukaryotic vaccinal vector carrying the human cytomegalovirus immediate early-promoter and the bovine growth hormone polyadenylation signal after linearization by BamHI-XbaI double digestion to generate pcDNA3.1::DnaK. pcDNA3.1::DnaK and pcDNA3.1 control plasmid were purified after an overnight Luria Bertani (LB) culture of recombinant DH5a E. coli using the EndoFree™ (Héchard et al., 2002).
Detailed Gene Information: Click here.

f. Vector:

pcDNA3.1

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: OF1 Swiss
Vaccination Protocol: Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan, Rosans, France) into the tibialis anterior muscles of both ind legs. Cardiotoxin induces a local inflammation and enhances the uptake of plasmid DNA. Five days later, the mice were anesthetized by intraperitoneal injection of ketamine and xylazine (80 and 8 mg/kg of body weight, respectively) and immunized with pcDNA3.1 or pcDNA3.1::DnaK plasmids by intramuscular injections (50 mg in each tibialis anterior). The mice were boosted in the same way at days 21 and 42, mated at day 51 and challenged at day 63 by an intraperitoneal injection of 2 ´ 10^5 plaque forming units (pfu) of C. abortus AB7 (Héchard et al., 2002).
Challenge Protocol: Four groups of 16 non-pregnant mice were made for immunological trials. Non-pregnant mice were used in order to collect samples without affecting the pregnancy of the mice. Moreover, a good vaccine must be able to protect pregnant and non-pregnant animals. As for the mice of the abortion test, these non-pregnant mice were immunized with the 1B vaccine, pcDNA3.1 or pcDNA3.1::DnaK.One additional group was immunized by PBS (same quantity, site and time as the DNA injections) and consequently was related as the virulence control group (Héchard et al., 2002).
Efficacy: In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
Host Gene Response of Ighv1-9
- Gene Response: In non-pregnant mice, the dnaK vaccine induced a specific humoral response with the predominant serum IgG2a isotope. No antibody response was detected in non-immunized mice or with the control plasmid. Increases in serum IgG2a were seen at day 41, increasing until day 61 with a drop on day 68 to levels similar to those seen on day 41 (Héchard et al., 2002).
- Detailed Gene Information: Click here.

4. C. abortus DNA vaccine encoding DnaX

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus DNA polymerase III subunit gamma/tau antigen dnaX

e. Gene Engineering of dnaX

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).

5. C. abortus DNA vaccine encoding GatA/GatB

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus Glu-tRNA Gln Amidotransferase gatA and gatB

e. Gene Engineering of gatA

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Gene Engineering of gatB

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

g. Vector:

pCMVi-UB

h. Immunization Route

Intramuscular injection (i.m.)

i. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatA/gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

6. C. abortus DNA vaccine encoding GatC

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus aspartyl/glutamyl-tRNA amidotransferase subunit C

e. Gene Engineering of gatC

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #2, gatC) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

7. C. abortus DNA vaccine encoding MOMP

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus major outer membrane protein omp1

e. Gene Engineering of omp1

Type: DNA vaccine construction
Description: The momp (omp1) gene was amplified by PCR and cloned into the vector pcDNA3.1 (Invitrogen) carrying the human cytomegalovirus immediate early promoter and the bovine growth hormone polyadenylation signal. The PCR was performed using chlamydial genomic DNA (80 ng) as template with dNTPs (200 µM each), specific primers (1 µM each) and 1 U Pfu DNA polymerase (Promega) in a Perkin Elmer 9600 thermocycler. The resulting fragment was inserted into the vector pcDNA3.1 after linearization by EcoRI/XhoI double digestion to generate pcDNA3.1 : : MOMP. The plasmid pcDNA3.1 : : MOMP and the pcDNA3.1 control plasmid were purified after an overnight Luria–Bertani culture of recombinant Escherichia coli DH5 using the EndoFree Plasmid Mega kit (Qiagen). Plasmid DNA was dissolved at 1 µg µl-1 in endotoxin-free PBS (Sigma) (Héchard et al., 2003).
Detailed Gene Information: Click here.

f. Vector:

pcDNA3.1 (Invitrogen)

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: OF1 Swiss
Vaccination Protocol: Prior to DNA immunization, each mouse was injected with cardiotoxin (Latoxan) into the tibialis anterior muscles of both hind legs to enhance the uptake of plasmid DNA (Davis et al., 1993). Five days later, mice were anaesthetized by an intraperitoneal injection of ketamine and xylazine (respectively 80 and 8 mg kg-1 body weight) and immunized with pcDNA3.1 : : MOMP plasmid by intramuscular injections (50 µg in each tibialis anterior). Mice were boosted in the same way at days 21 and 42. The negative-control mice were immunized intramuscularly with endotoxin-free PBS (virulence control) or pcDNA3.1 plasmid. Positive-control mice were immunized with one subcutaneous injection of 4 x 10^4 p.f.u. of the live attenuated 1B vaccine at day 1 (Héchard et al., 2003).
Challenge Protocol: The five groups of pregnant mice were mated at day 44. Non-pregnant and pregnant mice were challenged at day 58 by an intraperitoneal injection of 4 x 10^4 p.f.u. C. abortus AB7. One group of pregnant mice neither immunized nor challenged was kept as a control for the pregnancy (gestation control) (Héchard et al., 2003).
Efficacy: The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
Host Gene Response of Ighv1-9
- Gene Response: In non-pregnant mice, the MOMP DNA vaccine elicited a specific humoral response with predominantly serum IgG2a antibodies, suggesting a Th1-type immune response. No antibody response was detected in non-immunized mice or mice immunized with the control plasmid. The anti-MOMP IgG titre reached a maximum in the non-pregnant mice immunized with pcDNA3.1 : : MOMP after the third DNA injection (day 56) and decreased after challenge (day 63) (Héchard et al., 2003).
- Detailed Gene Information: Click here.

8. C. abortus DNA vaccine encoding OmlA

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus omlA

e. Gene Engineering of omlA

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).

9. C. abortus DNA vaccine Pomp90A

a. Vaccine Ontology ID:

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

C. abortus polymorphic outer membrane protein 90A (pomp90A)

e. Gene Engineering of pomp90A

Type: DNA vaccine construction
Description: To create the library of genetic immunization plasmids, genomic DNA of C. abortus strain B577 was physically sheared and cloned into the genetic immunization vector pCMVi-UB, which drives transcription using the strong mammalian CMV promoter (Stemke-Hale et al., 2005).
Detailed Gene Information: Click here.

f. Vector:

pCMVi-UB

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Doses of 50 μg library DNA were delivered intramuscularly to the quadriceps and tibialis anterior muscles. Doses of 2.5 μg DNA were delivered to the ear skin of mice with a gene gun. C. abortus B577 was grown in BGMK cells and titrated for IFU in BGMK shell vial coverslip cultures by enumeration of chlamydial inclusions stained with FITC-labeled monoclonal antibody against chlamydial LPS. For rounds 1 and 2 of ELI, mice were boosted 9 weeks after the prime inoculation in the same manner, and for rounds 3 and 4 of ELI the mice were given an additional boost 5 weeks after the prime (Stemke-Hale et al., 2005).
Challenge Protocol: In all cases, mice were challenged at 13 weeks with a dose of 3 × 10^6 inclusion forming units (IFU) of C. abortus administered intranasally. The positive control group representing protection received a low dose intranasal inoculation of 3 × 10^4 IFU of the same live strain four weeks prior to the high-dose challenge (Stemke-Hale et al., 2005).
Efficacy: Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).

10. Ovilis Enzovax

a. Tradename:

Ovilis Enzovax

b. Manufacturer:

Intervet

c. Vaccine Ontology ID:

d. Type:

Live, attenuated vaccine

e. Status:

Licensed

f. Host Species for Licensed Use:

Sheep

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

Live temperature-sensitive mutant strain for subcutaneous or intramuscular injection(Chalmers et al., 1997)

V. References

1. Bandholtz et al., 2002: Bandholtz L, Kreuger MR, Svanholm C, Wigzell H, Rottenberg ME. Adjuvant modulation of the immune responses and the outcome of infection with Chlamydia pneumoniae. Clinical and experimental immunology. 2002; 130(3); 393-403. [PubMed: 12452828].

2. Chalmers et al., 1997: Chalmers WS, Simpson J, Lee SJ, Baxendale W. Use of a live chlamydial vaccine to prevent ovine enzootic abortion. The Veterinary record. 1997; 141(3); 63-67. [PubMed: 9257434].

3. Héchard et al., 2002: Héchard C, Grépinet O, Rodolakis A. Protection evaluation against Chlamydophila abortus challenge by DNA vaccination with a dnaK-encoding plasmid in pregnant and non-pregnant mice. Veterinary research. 2002; 33(3); 313-326. [PubMed: 12056482].

4. Héchard et al., 2003: Héchard C, Grépinet O, Rodolakis A. Evaluation of protection against Chlamydophila abortus challenge after DNA immunization with the major outer-membrane protein-encoding gene in pregnant and non-pregnant mice. Journal of medical microbiology. 2003; 52(Pt 1); 35-40. [PubMed: 12488563].

5. H�chard et al., 2004: H�chard C, Gr�pinet O, Rodolakis A. Molecular cloning of the Chlamydophila abortus groEL gene and evaluation of its protective efficacy in a murine model by genetic vaccination. Journal of medical microbiology. 2004; 53(Pt 9); 861-868. [PubMed: 15314192].

6. Stemke-Hale et al., 2005: Stemke-Hale K, Kaltenboeck B, DeGraves FJ, Sykes KF, Huang J, Bu CH, Johnston SA. Screening the whole genome of a pathogen in vivo for individual protective antigens. Vaccine. 2005; 23(23); 3016-3025. [PubMed: 15811648].

7. Wiki: Chlamydophila abortus: Chlamydophila abortus [http://en.wikipedia.org/wiki/Chlamydophila_abortus]