Vibrio anguillarum (Listonella anguillarum) |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- ompU
(Protective antigen)
- Vaccine Information
- AquaVac Vibrio
- Infectious Salmon Anemia Virus Killed Virus Vaccine-Aeromonas Salmonicida-Vibrio Anguillarum-Ordalii-Salmonicida Bacterin (USDA: 4A45.20)
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
55601 |
|
2. Disease: |
| Vibrosis |
|
3. Introduction |
| Vibrosis is one of the most prevalent fish diseases caused by bacteria belonging to the genus Vibrio. Vibriosis caused by Vibrio anguillarum has been particularly devastating in the marine culture of salmonid fish. Vibriosis occurs in cultured and wild marine fish in salt or brackish water, particularly in shallow waters during late summer. It was originally believed that scavenger fish feeding around the farms were the natural reservoir of V. anguillarum, and contact between fish seems to be an important factor for the spread of this pathogen. However, there is evidence that V. anguillarum is normally present in the food of cultured and wild healthy fish. The temperature and quality of the water, the virulence of the V. anguillarum strain and stress on the fish are important elements influencing the onset of disease outbreaks (Vibriosis). |
| II. Vaccine Related Pathogen Genes |
|
1. ompU |
-
Gene Name :
ompU
-
Sequence Strain (Species/Organism) :
Listonella anguillarum
-
VO ID :
VO_0011344
-
NCBI Protein GI :
26513901
-
Other Database IDs :
CDD:225744
CDD:238208
-
Taxonomy ID :
55601
-
Gene Strand (Orientation) :
?
-
Protein Name :
major outer membrane protein OmpU
-
Protein pI :
4.45
-
Protein Weight :
33790.35
-
Protein Length :
403
-
Protein Note :
Outer membrane protein (porin) [Cell wall/membrane/envelope biogenesis]; COG3203
-
Protein Sequence : Show Sequence
>AAN78349.1 major outer membrane protein OmpU [Vibrio anguillarum]
MNKTLIALAVSAAAVVTGVNAGELYNQDGTSLEMGGRAEARLSLKDGKADDASRVRLNFLGKVAINDSLY
GVGFYEGEFTTADEGTADNKGDLDNRYTYAGIGGNFGEVTYGKNDGALGVITDFTDIMSYHGNKAAYKIV
VADRVDNMVAYKGQFADLGVKASYRFADRQESTSAITDNNADGYSLSAIYAIGDTGVKLGAGYADQDTAA
NASSDQYMLAASYAISDFYFAGTFVDGQDKAASKTDKTGYELAAKYTMGQAVFTSTYNYLESKNSGAKKD
KADSFAVDATYFFKPNFRSYISYNFNLLDSDKVGKAKSEDELALGLRYDF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Asian seabass vaccinated with the OMP38 (OmpU) DNA vaccine was challenged with pathogenic V. anguillarum by intramuscular injection. A relative percent survival (RPS) rate of 55.6% was recorded (Kumar et al., 2007).
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. AquaVac Vibrio |
| a. Tradename: |
| AquaVac Vibrio |
| b. Manufacturer: |
| Schering-Plough Animal Health |
| c. Vaccine Ontology ID: |
| VO_0001071 |
| d. Type: |
| Inactivated or "killed" vaccine |
| e. Status: |
| Licensed |
| f. Host Species for Licensed Use: |
| Fish |
| g. Immunization Route |
| Oral |
|
|
|
 |
|
 |
|
|
|
|
|
|
|
|
|
2. Infectious Salmon Anemia Virus Killed Virus Vaccine-Aeromonas Salmonicida-Vibrio Anguillarum-Ordalii-Salmonicida Bacterin (USDA: 4A45.20) |
| a. Manufacturer: |
| Novartis Animal Health US, Inc |
| b. Vaccine Ontology ID: |
| VO_0002320 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Fish |
|
|
|
|
|
|
|
|
| IV. References |
1. Kumar et al., 2007: Kumar SR, Parameswaran V, Ahmed VP, Musthaq SS, Hameed AS. Protective efficiency of DNA vaccination in Asian seabass (Lates calcarifer) against Vibrio anguillarum. Fish & shellfish immunology. 2007; 23(2); 316-326. [PubMed: 17337208].
2. Vibriosis: Vibriosis [http://www.spaquaculture.com/default.aspx?pageid=528]
|
