|
|
Yersinia ruckeri |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- aroA
(Virmugen)
- Vaccine Information
- AquaVac ERM
- Yersinia ruckeri aroA mutant vaccine
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
29486 |
|
2. Disease: |
| Enteric redmouth disease |
|
3. Introduction |
| Yersinia ruckeri is the causative agent of yersiniosis or enteric redmouth disease leading to significant economic losses in salmonid aquaculture worldwide. Infection may result in a septicaemic condition with haemorrhages on the body surface and in the internal organs. Despite the significance of the disease, very little information is available on the pathogenesis, hampering the development of preventive measures to efficiently combat this bacterial agent (Tobback et al., 2007). |
| II. Vaccine Related Pathogen Genes |
|
1. aroA |
-
Gene Name :
aroA
-
NCBI Protein GI :
15420539
-
Other Database IDs :
CDD:179423
CDD:30129
-
Taxonomy ID :
29486
-
Gene Strand (Orientation) :
?
-
Protein Name :
5-enolpyruvylshikimate-3-phosphate synthase
-
Protein Length :
427
-
Protein Note :
3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
-
Protein Sequence : Show Sequence
>gi|15420539|gb|AAK97382.1|AF360730_1 5-enolpyruvylshikimate-3-phosphate synthase [Yersinia ruckeri]
MLESLTLQPIALINGTVNLPGSKSVSNRALLLAALAEGTTRLHNLLDSDDIRHMLNALKSLGVNYRLSAD
RTQCDVDGLGGPLVADKTLELFLGNAGTAMRPLAAALCLGYSDIVLTGEERMKERPIGHLVDALEGGAQI
DYLEQENYPPLRIRGGFRGGELTVDGSVSSQFLTALLMAAPLATQDTHIRIQGDLVSRPYIDITLHLMRS
FGVEVTHQNYQVFHIQGGQTYHSPGEYLVEGDASSASYFLAAAAIKGGTVRVTGIGKKSVQGDTKFADVL
EKMGAIIHWGDDYIECSRGELRDIDMDMNHIPDAAMTIATAALFAKGPTIIRNIYNWRVKETDRLSAMAT
ELRKVGAEVEEGQDYIRVVPPAHLIAAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARLSVLA
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
An aroA mutant is highly attenuated in rainbow trout and induces significant protection from challenge with wild type Y. ruckeri (Temprano et al., 2005).
- Related Vaccine(s):
Yersinia ruckeri aroA mutant vaccine
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. AquaVac ERM |
| a. Tradename: |
| AquaVac ERM |
| b. Manufacturer: |
| Schering-Plough Animal Health |
| c. Vaccine Ontology ID: |
| VO_0000842 |
| d. Type: |
| Inactivated or "killed" vaccine |
| e. Status: |
| Licensed |
| f. Host Species for Licensed Use: |
| Fish |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h. Description |
| Killed oral vaccine |
|
|
|
 |
|
 |
|
|
|
|
|
|
|
|
|
2. Yersinia ruckeri aroA mutant vaccine |
| a. Vaccine Ontology ID: |
| VO_0002948 |
| b. Type: |
| Live, attenuated vaccine |
| c. Status: |
| Research |
| d. Host Species as Laboratory Animal Model: |
| Rainbow trout |
| e. Gene Engineering of
aroA |
|
| f. Immunization Route |
| Intraperitoneal injection (i.p.) |
| g.
Rainbow trout Response |
|
|
|
|
|
|
|
|
|
| IV. References |
1. Temprano et al., 2005: Temprano A, Riaño J, Yugueros J, González P, de Castro L, Villena A, Luengo JM, Naharro G. Potential use of a Yersinia ruckeri O1 auxotrophic aroA mutant as a live attenuated vaccine. Journal of fish diseases. 2005; 28(7); 419-427. [PubMed: 16083447].
2. Tobback et al., 2007: Tobback E, Decostere A, Hermans K, Haesebrouck F, Chiers K. Yersinia ruckeri infections in salmonid fish. Journal of fish diseases. 2007; 30(5); 257-268. [PubMed: 17501736].
3. Yang et al., 2009: Yang H, Chen J, Yang G, Zhang XH, Liu R, Xue X. Protection of Japanese flounder (Paralichthys olivaceus) against Vibrio anguillarum with a DNA vaccine containing the mutated zinc-metalloprotease gene. Vaccine. 2009; 27(15); 2150-2155. [PubMed: 19356619].
|
|
