Canine distemper virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- CDVgp5
(Protective antigen)
- CDVgp6 haemagglutinin protein H
(Protective antigen)
- Vaccine Information
- ALVAC- CDV-H/F
- Canine distemper virus DNA vaccine encoding F and HA
- Canine distemper virus DNA vaccine encoding HA
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine (USDA: 13A1.20)
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine (USDA: 13A1.27)
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27)
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.21)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.25)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.29)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus; Canarypox Vector Vaccine (USDA: 1591.R1)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
- Canine Distemper-Adenovirus Type 2-Measles-Parainfluenza Modified Live Virus Vaccine (USDA: 1341.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine (USDA: 13C1.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.21)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.22)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.23)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.25)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.27)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.28)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.29)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.T0)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Canarypox Vector Vaccine (USDA: 13D1.R1)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus-Rabies Modified Live & Killed Virus Vaccine (USDA: 13G9.20)
- Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.20)
- Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.25)
- Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.27)
- Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.30)
- Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus, Canarypox Vector Vaccine (USDA: 1331.R1)
- Canine Distemper-Adenovirus Type 2-Parvovirus-Rabies Modified Live & Killed Virus Vaccine (USDA: 13H9.20)
- Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D7.20)
- Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D9.27)
- Canine Distemper-Hepatitis-Parainfluenza Modified Live Virus Vaccine (USDA: 1381.21)
- Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22)
- Canine Distemper-Measles Modified Live Virus Vaccine (USDA: 1351.20)
- Canine Distemper-Parvovirus Modified Live Virus Vaccine (USDA: 13P1.20)
- Canine Distemper-Parvovirus Modified Live Virus Vaccine (USDA: 13P1.27)
- Distemper Live Canarypox Vector Vaccine (USDA: 1471.R0)
- Distemper Modified Live Virus Vaccine (USDA: 1471.10)
- Mink Distemper Modified Live Virus Vaccine (USDA: 1451.00)
- Mink Distemper Modified Live Virus Vaccine (USDA: 1451.01)
- Mink Distemper Modified Live Virus Vaccine (USDA: 1451.20)
- Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine (USDA: 1679.31)
- Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C Bacterin-Toxoid (USDA: 4929.31)
- Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.20)
- Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.31)
- Mink Distemper-Enteritis Modified Live Virus & Killed Virus Vaccine-Clostridium Botulinum Type C Bacterin-Toxoid (USDA: 4929.20)
- NYVAC- CDV-H/F
- PUREVAXFerret Distemper
- RECOMBITEK rDistemper
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11232 |
2. Disease: |
Canine distemper |
3. Introduction |
Canine distemper is a very serious viral disease that affects animals in the families Canidae, Mustelidae, Mephitidae, Hyaenidae, Ailuridae, Procyonidae, Pinnipedia, some Viverridae and Felidae. It is most commonly associated with domestic animals such as dogs and ferrets, although it can infect wild animals as well. It is a single-stranded RNA virus of the family paramyxovirus, and thus a close relative of measles and rinderpest. Despite extensive vaccination in many regions, it remains a major disease of dogs.
Canine distemper virus (CDV) spreads through the aerosol droplets and through contact with infected bodily fluids including nasal and ocular secretions, feces, and urine 6–22 days after exposure. It can also be spread by food and water contaminated with these fluids. The time between infection and disease is 14 to 18 days, although there can be a fever from three to six days postinfection.
The mortality rate of the virus largely depends on the immune status of the infected dogs. Puppies experience the highest mortality rate where complications such as pneumonia and encephalitis are more common. In older dogs that do develop distemper encephalomyelitis, vestibular disease may present. Around 15% of canine inflammatory central nervous system diseases are a result of CDV (Wiki: Canine distemper virus). |
4. Microbial Pathogenesis |
Canine distemper virus tends to orient its infection towards the lymphoid, epithelial, and nervous tissues. The virus initially replicates in the lymphatic tissue of the respiratory tract. The virus then enters the blood stream and infects the lymphatic tissue followed by respiratory, Gastrointestinal, urogenital epithelium, the Central Nervous System, and optic nerves. Therefore, the typical pathologic features of canine distemper include lymphoid depletion (causing immunosuppression and leading to secondary infections), interstitial pneumonia, encephalitis with demyelination, and hyperkeratosis of foot pads (Wiki: Canine distemper virus). |
5. Host Ranges and Animal Models |
It is most commonly associated with domestic animals such as dogs and ferrets, although it can infect wild animals as well (Wiki: Canine distemper virus). |
II. Vaccine Related Pathogen Genes |
1. CDVgp5 |
-
Gene Name :
CDVgp5
-
Sequence Strain (Species/Organism) :
Canine morbillivirus
-
VO ID :
VO_0011053
-
NCBI Gene ID :
1489793
-
NCBI Protein GI :
9630650
-
Locus Tag :
CDVgp5
-
Genbank Accession :
AF014953
-
Protein Accession :
NP_047205
-
Taxonomy ID :
11232
-
Gene Starting Position :
4934
-
Gene Ending Position :
6922
-
Gene Strand (Orientation) :
+
-
Protein Name :
fusion protein F
-
Protein pI :
9.25
-
Protein Weight :
69080.65
-
Protein Length :
662
-
DNA Sequence : Show Sequence
>NC_001921.1:4934-6922 Canine distemper virus, complete genome
CATGCACAAGGGAATCCCCAAAAGCTCCAAAACCCAAACACATACCCAACAAGACCGCCCCCCACAACCC
AGCACCGAACTCGAAGAGACCAGGACCTCCCGAGCACGACACAGCACAACATCAGCTCAGCGATCCACGC
ACTACGATCCTCGAACATCGGACAGACCCGTCTCCTACACCATGAACAGGACCAGGTCCCGCAAGCAAAC
CAGCCACAGATTGAAGAACATCCCAGTTCACGGAAACCACGAGGCCACCATCCAGCACATACCAGAGAGT
GTCTCAAAAGGAGCGAGATCCCAGATCGAAAGGCGGCAACCCAATGCAATCAACTCAGGCTCTCAGTGCA
CCTGGTTAGTCCTGTGGTGCCTCGGAATGGCCAGTCTCTTTCTTTGTTCCAAGGCTCAGATACATTGGAA
TAATTTGTCAACTATTGGGATTATCGGGACTGATAGTGTCCATTACAAGATCATGACTAGGCCCAGTCAC
CAGTACTTGGTCATAAAACTGATGCCTAATGTTTCACTTATAGAGAATTGTACCAAAGCAGAATTAGGTG
AGTATGAGAAATTATTGAATTCAGTCCTCGAACCAATCAACCAAGCTTTGACTCTAATGACCAAGAATGT
GAAGCCCCTGCAGTCATTAGGGTCAGGTAGGAGACAAAGGCGTTTTGCAGGAGTGGTACTTGCAGGTGTA
GCTTTAGGAGTGGCTACAGCTGCACAAATCACTGCAGGAATAGCTTTACATCAATCCAACCTCAATGCTC
AAGCAATCCAATCTCTTAGAACCAGCCTTGAACAGTCTAACAAAGCTATAGAAGAAATTAGGGAGGCTAC
CCAAGAAACCGTCATTGCCGTTCAGGGAGTCCAGGACTACGTCAACAACGAACTCGTCCCTGCCATGCAA
CATATGTCATGTGAATTAGTTGGGCAGAGATTAGGGTTAAGACTGCTTCGGTATTATACTGAGTTGTTGT
CAATATTTGGCCCGAGTTTACGTGACCCTATTTCAGCCGAGATATCAATTCAGGCACTGATTTATGCTCT
TGGAGGAGAAATTCATAAGATACTTGAGAAGTTGGGATATTCTGGAAGTGATATGATTGCAATCTTGGAG
AGTCGGGGGATAAAAACAAAAATAACTCATGTTGATCTTCCCGGGAAATTCATCATCCTAAGTATCTCAT
ACCCAACTTTATCAGAAGTCAAGGGGGTTATAGTCCACAGACTGGAAGCAGTTTCTTACAACATAGGATC
ACAAGAGTGGTACACCACTGTCCCGAGGTATATTGCAACTAATGGTTACTTAATATCTAATTTTGATGAG
TCATCTTGTGTATTCGTCTCAGAGTCAGCCATTTGTAGCCAGAACTCCCTGTATCCCATGAGCCCACTCT
TACAACAATGTATTAGGGGCGACACTTCATCTTGTGCTCGGACCTTGGTATCTGGGACTATGGGCAACAA
ATTTATTCTGTCAAAAGGTAATATCGTCGCAAATTGTGCTTCTATACTATGTAAGTGTTATAGCACAAGC
ACAATTATTAATCAGAGTCCTGATAAGTTGCTGACATTCATTGCCTCCGATACCTGCCCACTGGTTGAAA
TAGATGGTGCTACTATCCAAGTTGGAGGCAGGCAATACCCTGATATGGTATACGAAGGCAAAGTTGCCTT
AGGCCCTGCTATATCACTTGATAGGTTAGATGTAGGTACAAACTTAGGGAACGCCCTTAAGAAACTGGAT
GATGCTAAGGTACTGATAGACTCCTCTAACCAGATCCTTGAGACGGTTAGGCGCTCTTCCTTTAATTTTG
GCAGTCTCCTCAGTGTTCCTATATTAAGTTGTACAGCCCTGGCTTTGTTGTTGCTGATTTACTGTTGTAA
AAGACGCTACCAACAGACACTCAAGCAGCATACTAAGGTCGATCCGGCATTTAAACCTGATCTAACTGGA
ACTTCGAAATCCTATGTGAGATCACTCTG
-
Protein Sequence : Show Sequence
>NP_047205.1 fusion protein F [Canine morbillivirus]
MHKGIPKSSKTQTHTQQDRPPQPSTELEETRTSRARHSTTSAQRSTHYDPRTSDRPVSYTMNRTRSRKQT
SHRLKNIPVHGNHEATIQHIPESVSKGARSQIERRQPNAINSGSQCTWLVLWCLGMASLFLCSKAQIHWN
NLSTIGIIGTDSVHYKIMTRPSHQYLVIKLMPNVSLIENCTKAELGEYEKLLNSVLEPINQALTLMTKNV
KPLQSLGSGRRQRRFAGVVLAGVALGVATAAQITAGIALHQSNLNAQAIQSLRTSLEQSNKAIEEIREAT
QETVIAVQGVQDYVNNELVPAMQHMSCELVGQRLGLRLLRYYTELLSIFGPSLRDPISAEISIQALIYAL
GGEIHKILEKLGYSGSDMIAILESRGIKTKITHVDLPGKFIILSISYPTLSEVKGVIVHRLEAVSYNIGS
QEWYTTVPRYIATNGYLISNFDESSCVFVSESAICSQNSLYPMSPLLQQCIRGDTSSCARTLVSGTMGNK
FILSKGNIVANCASILCKCYSTSTIINQSPDKLLTFIASDTCPLVEIDGATIQVGGRQYPDMVYEGKVAL
GPAISLDRLDVGTNLGNALKKLDDAKVLIDSSNQILETVRRSSFNFGSLLSVPILSCTALALLLLIYCCK
RRYQQTLKQHTKVDPAFKPDLTGTSKSYVRSL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Study reports the engineering and the characterization of two replication-competent canine adenovirus type 2 (CAV2)-based vaccines expressing, respectively, the CDV hemagglutinin (HA) and fusion (F) antigens (CDVgp5). We first demonstrated that the intranasal vaccination with a mixture of both recombinant CAV2s provides an excellent level of protection in seronegative puppies, confirming the value of replication-competent adenovirus-based vectors for mucosal vaccination (Fischer et al., 2002).
- Related Vaccine(s):
ALVAC- CDV-H/F
,
Canine distemper virus DNA vaccine encoding F and HA
,
NYVAC- CDV-H/F
|
2. CDVgp6 haemagglutinin protein H |
-
Gene Name :
CDVgp6 haemagglutinin protein H
-
Sequence Strain (Species/Organism) :
Canine morbillivirus
-
VO ID :
VO_0011052
-
NCBI Gene ID :
1489792
-
NCBI Protein GI :
9630651
-
Locus Tag :
CDVgp6
-
Genbank Accession :
AB472690
-
Protein Accession :
NP_047206
-
Taxonomy ID :
11232
-
Gene Starting Position :
7078
-
Gene Ending Position :
8892
-
Gene Strand (Orientation) :
+
-
Protein Name :
haemagglutinin protein H
-
Protein pI :
7.18
-
Protein Weight :
63919.26
-
Protein Length :
604
-
DNA Sequence : Show Sequence
>NC_001921.1:7078-8892 Canine distemper virus, complete genome
AATGCTCCCCTACCAAGACAAGGTGGGTGCCTTCTACAAGGATAATGCAAGAGCCAATTCAACCAAGCTG
TCCTTAGTGACAGAAGGACATGGGGGCAGGAGACCACCTTATTTGTTGTTTGTCCTTCTCATCTTATTGG
TTGGTATCCTGGCCTTGCTTGCTATCACTGGAGTTCGATTTCACCAAGTATCAACTAGTAATATGGAATT
TAGCAGATTGCTGAAAGAGGATATGGAGAAATCAGAGGCCGTACATCACCAAGTCATAGATGTCTTGACA
CCGCTCTTCAAGATTATTGGAGATGAGATTGGGTTACGGTTGCCACAAAAGCTAAACGAGATCAAACAAT
TTATCCTTCAAAAGACAAATTTCTTCAATCCGAACAGAGAATTCGACTTCCGCGATCTCCACTGGTGCAT
TAACCCGCCTAGTACGGTCAAGGTGAATTTTACTAATTACTGTGAGTCAATTGGGATCAGAAAAGCTATT
GCATCGGCAGCAAATCCTATCCTTTTATCAGCCCTATCTGGGGGCAGAGGTGACATATTCCCACCACACA
GATGCAGTGGAGCTACTACTTCAGTAGGCAAAGTTTTCCCCCTATCAGTCTCATTATCCATGTCTTTGAT
CTCAAGAACCTCAGAGGTAATCAATATGCTGACCGCTATCTCAGACGGCGTGTATGGCAAAACTTACTTG
CTAGTGCCTGATGATATAGAAAGAGAGTTCGACACTCGAGAGATTCGAGTCTTTGAAATAGGGTTCATCA
AAAGGTGGCTGAATGACATGCCATTACTCCAAACAACCAACTATATGGTACTCCCGAAGAATTCCAAAGC
CAAGGTATGTACTATAGCAGTGGGTGAGTTGACACTGGCTTCCTTGTGTGTAGAAGAGAGCACTGTATTA
TTATATCATGACAGCAGTGGTTCACAAGATGGTATTCTAGTAGTGACACTGGGGATATTTTGGGCAACAC
CTATGGATCACATTGAGGAAGTGATACCTGTCGCTCACCCATCAATGAAGAAAATACATATAACAAACCA
CCGTGGTTTTATAAAAGATTCAATTGCAACCTGGATGGTGCCTGCCCTGGCCTCTGAGAAACAAGAAGAA
CAAAAAGGTTGTCTGGAGTCAGCTTGTCAAAGAAAAACCTACCCCATGTGCAACCAAGCGTCATGGGAAC
CCTTCGGAGGAAGACAGTTGCCATCTTATGGGCGGTTGACATTACCTCTAGATGCAAGTGTTGACCTTCA
ACTTAACATATCGTTCACATACGGTCCGGTTATACTGAATGGAGATGGTATGGATTATTATGAAAGCCCA
CTTTTGAACTCCGGATGGCTTACCATTCCCCCCAAAGACGGAACAATCTCTGGATTGATAAACAAAGCAG
GTAGAGGAGACCAGTTCACTGTACTCCCCCATGTGTTAACATTTGCGCCCAGGGAATCAAGTGGAAATTG
TTATTTACCTATTCAAACATCTCAAATTAGAGATAGAGATGTCCTCATTGAGTCCAATATAGTGGTGTTG
CCTACACAGAGTATTAGATATGTCATAGCAACGTATGACATATCACGAAGTGATCATGCTATTGTTTATT
ATGTTTATGACCCAATCCGGACGATTTCTTATACGCACCCATTTAGACTAACTACCAAGGGTAGACCTGA
TTTCCTAAGGATTGAATGTTTTGTGTGGGATGACAATTTGTGGTGTCACCAATTTTACAGATTCGAGGCT
GACATCGCCAACTCTACAACCAGTGTTGAGAATTTAGTCCGTATAAGATTCTCATGTAACCGTTA
-
Protein Sequence : Show Sequence
>NP_047206.1 haemagglutinin protein H [Canine morbillivirus]
MLPYQDKVGAFYKDNARANSTKLSLVTEGHGGRRPPYLLFVLLILLVGILALLAITGVRFHQVSTSNMEF
SRLLKEDMEKSEAVHHQVIDVLTPLFKIIGDEIGLRLPQKLNEIKQFILQKTNFFNPNREFDFRDLHWCI
NPPSTVKVNFTNYCESIGIRKAIASAANPILLSALSGGRGDIFPPHRCSGATTSVGKVFPLSVSLSMSLI
SRTSEVINMLTAISDGVYGKTYLLVPDDIEREFDTREIRVFEIGFIKRWLNDMPLLQTTNYMVLPKNSKA
KVCTIAVGELTLASLCVEESTVLLYHDSSGSQDGILVVTLGIFWATPMDHIEEVIPVAHPSMKKIHITNH
RGFIKDSIATWMVPALASEKQEEQKGCLESACQRKTYPMCNQASWEPFGGRQLPSYGRLTLPLDASVDLQ
LNISFTYGPVILNGDGMDYYESPLLNSGWLTIPPKDGTISGLINKAGRGDQFTVLPHVLTFAPRESSGNC
YLPIQTSQIRDRDVLIESNIVVLPTQSIRYVIATYDISRSDHAIVYYVYDPIRTISYTHPFRLTTKGRPD
FLRIECFVWDDNLWCHQFYRFEADIANSTTSVENLVRIRFSCNR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Young mink kits (n=8) were vaccinated with DNA plasmids encoding the viral haemagglutinin protein (H) of a vaccine strain of Canine distemper virus (CDV). The mink were protected against viraemia, lymphopenia, clinical disease and changes in the percentage of IFN-gamma producing peripheral blood leucocytes after challenge inoculation with a recent wild type strain of CDV. Essentially, these results demonstrate that early life DNA vaccination with the H gene of a CDV vaccine strain induced robust protective immunity against a recent wild type CDV (Jensen et al., 2009).
- Related Vaccine(s):
ALVAC- CDV-H/F
,
Canine distemper virus DNA vaccine encoding F and HA
,
Canine distemper virus DNA vaccine encoding HA
,
NYVAC- CDV-H/F
|
III. Vaccine Information |
|
|
|
|
|
|
1. ALVAC- CDV-H/F |
a. Vaccine Ontology ID: |
VO_0004773 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Baboon |
e. Gene Engineering of
CDVgp6 haemagglutinin protein H |
- Type:
Recombinant vector construction
- Description:
Attenuated vaccinia virus (NYVAC) or canarypox virus (ALVAC) vaccine strains expressing the CDV hemagglutinin (H) and fusion (F) protein genes (NYVAC-HF and ALVAC-HF) (Welter et al., 2000).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
CDVgp5 |
- Type:
Recombinant protein preparation
- Description:
Attenuated vaccinia virus (NYVAC) or canarypox virus (ALVAC) vaccine strains expressing the CDV hemagglutinin (H) and fusion (F) protein genes (NYVAC-HF and ALVAC-HF) (Welter et al., 2000).
- Detailed Gene Information: Click here.
|
g. Preparation |
An attenuated canarypox virus (ALVAC) vaccine strain expressing the CDV hemagglutinin (H) and fusion (F) protein genes (ALVAC-HF) (Welter et al., 2000). |
h. Immunization Route |
intranasal immunization |
i.
Ferret Response |
- Vaccination Protocol:
Ferrets without maternal antibody were vaccinated intranasally with NYVAC-HF and ALVAC-HF. While ferrets with maternal antibody were vaccinated parenterally with NYVAC-HF and ALVAC-HF (Welter et al., 2000).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
At 12 weeks of age, the ferrets were challenged with CDV (Welter et al., 2000).
- Efficacy:
Combined i.n.-parenteral immunization of ferrets with maternal antibody using NYVAC-HF produced higher titers than did i.n. immunization with NYVAC-HF and ALVAC-HF, and survival was also significantly better in the i.n.-parenteral group than in the other HF-vaccinated animals (none of 18) or in controls immunized with RG. Multiple routes were not tested with the ALVAC vaccine (Welter et al., 2000).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Canine distemper virus DNA vaccine encoding F and HA |
a. Vaccine Ontology ID: |
VO_0011489 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Canine distemper virus fusion and hemagglutinin antigens |
e. Gene Engineering of
CDVgp5 |
- Type:
DNA vaccine construction
- Description:
The Onderstepoort strain CDV HA and F cDNAs were amplified by PCR from a recombinant canarypox virus DNA using, respectively, primers pairs LF185 (5′-ATCGTCTCTAGAATGCTCCCCTACCAA-3′)/LF186 (5′-ATCGTCCGCCGCGGTTAACGGTTACATGAG-3′) and LF187 (5′-CTCGAGTCTAGAATGCACAAGGGAATCCCC-3′)/LF188 (5′-ATCCTGCCGCGGTCAGTGTGATCTCACATAGGATTT-3′). Five micrograms of purified CAV2 DNA were transfected into MDCK cells using Lipofectamine as described by the manufacturer (Gibco Lifesciences). After 24 h of incubation at 37 °C, the serum free medium was removed and replaced by supplemented MEM medium. The culture was incubated at 37 °C for 8 days with supplemented MEM medium being added to it on the third day(Fischer et al., 2002).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
CDVgp6 haemagglutinin protein H |
- Type:
DNA vaccine construction
- Description:
The Onderstepoort strain CDV HA and F cDNAs were amplified by PCR from a recombinant canarypox virus DNA using, respectively, primers pairs LF185 (5′-ATCGTCTCTAGAATGCTCCCCTACCAA-3′)/LF186 (5′-ATCGTCCGCCGCGGTTAACGGTTACATGAG-3′) and LF187 (5′-CTCGAGTCTAGAATGCACAAGGGAATCCCC-3′)/LF188 (5′-ATCCTGCCGCGGTCAGTGTGATCTCACATAGGATTT-3′). Five micrograms of purified CAV2 DNA were transfected into MDCK cells using Lipofectamine as described by the manufacturer (Gibco Lifesciences). After 24 h of incubation at 37 °C, the serum free medium was removed and replaced by supplemented MEM medium. The culture was incubated at 37 °C for 8 days with supplemented MEM medium being added to it on the third day (Fischer et al., 2002).
- Detailed Gene Information: Click here.
|
g. Vector: |
pCAT basic vector (Promega) |
h. Immunization Route |
Intranasal |
i.
Dog Response |
- Vaccination Protocol:
Dogs of group A were vaccinated on days 0 and 21 via the intranasal route with a mixture containing 105.8 TCID50/ml of vCA13 and 105.8 TCID50/ml of vCA17. Each nostril was infused with 0.5 ml of the vaccine solution. Dogs of group B were vaccinated on days 0 and 21 by the subcutaneous route (1 ml) with an non-relevant vaccine which did not contain CDV and/or CAV2 antigens. Experiment 2: Vaccinations were done with the same experimental design as in experiment 1, with the following exceptions: (1) all vaccinations were performed on days 0 and 28. Dogs of group A and B were vaccinated with 1 ml of a mixture of vCA13 and vCA17 containing 2×10^7 TCID50/ml of vCA13 and 2×107 TCID50/ml of vCA17; and (2) group C remained unvaccinated (Fischer et al., 2002).
- Challenge Protocol:
All dogs were challenged intravenously with the virulent NVSL strain of CDV on day 42 after receiving an intramuscular administration of diphenhydramine hydrochloride at 1 mg/lb. Challenge consisted of 10 ml (0.5 ml of 1:10 NVSL CDV stock diluted with 9.5 ml of cold PBS) administered intravenously into the cephalic vein. All dogs were observed daily for 2 days until 21 days after challenge to record morbidity and/or mortality (Fischer et al., 2002).
- Efficacy:
The intranasal vaccination with a mixture of both recombinant CAV2s provides an excellent level of protection in seronegative puppies, confirming the value of replication-competent adenovirus-based vectors for mucosal vaccination (Fischer et al., 2002).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Canine distemper virus DNA vaccine encoding HA |
a. Vaccine Ontology ID: |
VO_0011459 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Antigen |
Canine distemper virus hemagglutinin |
e. Gene Engineering of
CDVgp6 haemagglutinin protein H |
- Type:
DNA vaccine construction
- Description:
Immunisations were performed with the plasmid vector pV1J containing an insert of the H gene (1815 base pairs, named pCDV-H) of the Onderstepoort strain of CDV (Jensen et al., 2009).
- Detailed Gene Information: Click here.
|
f. Vector: |
plasmid vector pV1J |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Cat Response |
- Host Strain:
Tonkinese cat
- Vaccination Protocol:
The mink kits were vaccinated 4 times. The first vaccination was administered to 5 days old mink kits, the initial dose was 200 μg of the pCDV-H, and divided between 70 μg injected intradermally and 130 μg injected intramuscularly with 27 G 0.5 ml hypodermic needles. The intradermal injections were distributed on the posterior part of the back. The intramuscular injections were distributed in the quadriceps muscle of each thigh and in the tibialis muscles of each leg. The combination of intradermal and intramuscular injections was chosen because this combination induced solid protective immunity in adult mink. The second vaccination was applied at 3 weeks of age under anaesthesia (1–15 mg/kg each xylazine and ketamine). Anaesthesia was applied for animal welfare reasons and to ascertain correct injections since mink are difficult to restrain. The second vaccination consisted of 400 μg with 140 μg distributed intradermally and 260 μg distributed intramuscularly. The third and fourth vaccinations each of 400 μg were given at 6 and 9 weeks of age following the same procedure as the second vaccination (Jensen et al., 2009).
- Challenge Protocol:
The wild type virus used for the experimental challenge inoculation was isolated from a distemper outbreak in farmed mink in Denmark in 2004. This virus was named Mink/DK2004. The H gene of Mink/DK2004 showed 90% identity at the amino acid sequence level to the corresponding sequences of the Onderstepoort vaccine strain. A challenge dose of 3 × 10^5 TCID50 was administered partly intraperitoneally and intramuscularly (20% suspension) and to the conjunctival and nasal mucosa (10% suspension) to anaesthetised mink (Jensen et al., 2009).
- Efficacy:
The mink were protected against viraemia, lymphopenia, clinical disease and changes in the percentage of IFN-gamma producing peripheral blood leucocytes after challenge inoculation with a recent wild type strain of CDV. Essentially, these results demonstrate that early life DNA vaccination with the H gene of a CDV vaccine strain induced robust protective immunity against a recent wild type CDV (Jensen et al., 2009).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine (USDA: 13A1.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc., Neotech, LLC |
b. Vaccine Ontology ID: |
VO_0002098 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine (USDA: 13A1.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002099 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002207 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002206 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002136 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.21) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002137 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002138 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002139 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002241 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002242 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002219 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002231 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002234 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002246 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002230 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002232 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002233 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002226 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002227 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002229 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002236 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002235 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus; Canarypox Vector Vaccine (USDA: 1591.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002135 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002237 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Canine Distemper-Adenovirus Type 2-Measles-Parainfluenza Modified Live Virus Vaccine (USDA: 1341.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002095 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine (USDA: 13C1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002100 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002218 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.20) |
a. Manufacturer: |
Intervet Inc., Aceto Pharma Corp. |
b. Vaccine Ontology ID: |
VO_0002101 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.21) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002102 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.22) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002103 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.23) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002104 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002105 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002106 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.28) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002107 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002108 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine (USDA: 13D1.T0) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002110 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002211 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002214 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002245 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002215 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
44. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002216 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
45. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_ |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Licensed |
d. Location Licensed: |
USA |
e. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002209 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
47. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002210 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
48. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002212 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
49. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002213 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
50. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002228 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
51. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Canarypox Vector Vaccine (USDA: 13D1.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002109 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
52. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002217 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
53. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus-Rabies Modified Live & Killed Virus Vaccine (USDA: 13G9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002111 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
54. Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.20) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002090 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
55. Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002091 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
56. Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002092 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
57. Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus Vaccine (USDA: 1331.30) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002093 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
58. Canine Distemper-Adenovirus Type 2-Parvovirus Modified Live Virus, Canarypox Vector Vaccine (USDA: 1331.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002094 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
59. Canine Distemper-Adenovirus Type 2-Parvovirus-Rabies Modified Live & Killed Virus Vaccine (USDA: 13H9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002112 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
60. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D7.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002117 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
61. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002118 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
62. Canine Distemper-Hepatitis-Parainfluenza Modified Live Virus Vaccine (USDA: 1381.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002097 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
63. Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002247 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
64. Canine Distemper-Measles Modified Live Virus Vaccine (USDA: 1351.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002096 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
65. Canine Distemper-Parvovirus Modified Live Virus Vaccine (USDA: 13P1.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002113 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
66. Canine Distemper-Parvovirus Modified Live Virus Vaccine (USDA: 13P1.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002114 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
67. Distemper Live Canarypox Vector Vaccine (USDA: 1471.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001748 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
68. Distemper Modified Live Virus Vaccine (USDA: 1471.10) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001749 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
69. Mink Distemper Modified Live Virus Vaccine (USDA: 1451.00) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001536 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
70. Mink Distemper Modified Live Virus Vaccine (USDA: 1451.01) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001537 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
71. Mink Distemper Modified Live Virus Vaccine (USDA: 1451.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001538 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
72. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine (USDA: 1679.31) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001832 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
73. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C Bacterin-Toxoid (USDA: 4929.31) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001833 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
74. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001834 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
75. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.31) |
a. Manufacturer: |
United Vaccines, Inc. |
b. Vaccine Ontology ID: |
VO_0001835 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
76. Mink Distemper-Enteritis Modified Live Virus & Killed Virus Vaccine-Clostridium Botulinum Type C Bacterin-Toxoid (USDA: 4929.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001836 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Carnivores |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
77. NYVAC- CDV-H/F |
a. Vaccine Ontology ID: |
VO_0004772 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Baboon |
e. Gene Engineering of
CDVgp6 haemagglutinin protein H |
- Type:
Recombinant vector construction
- Description:
Attenuated vaccinia virus (NYVAC) or canarypox virus (ALVAC) vaccine strains expressing the CDV hemagglutinin (H) and fusion (F) protein genes (NYVAC-HF and ALVAC-HF) (Welter et al., 2000).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
CDVgp5 |
- Type:
Recombinant vector construction
- Description:
Attenuated vaccinia virus (NYVAC) or canarypox virus (ALVAC) vaccine strains expressing the CDV hemagglutinin (H) and fusion (F) protein genes (NYVAC-HF and ALVAC-HF) (Welter et al., 2000).
- Detailed Gene Information: Click here.
|
g. Preparation |
An attenuated vaccinia virus (NYVAC) vaccine strain expressing the CDV hemagglutinin (H) and fusion (F) protein genes (NYVAC-HF) (Welter et al., 2000). |
h. Immunization Route |
Intramuscular injection (i.m.) |
i.
Ferret Response |
- Vaccination Protocol:
Ferrets without maternal antibody were vaccinated intranasally with NYVAC-HF and ALVAC-HF. While ferrets with maternal antibody were vaccinated parenterally with NYVAC-HF and ALVAC-HF (Welter et al., 2000).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
At 12 weeks of age, the ferrets were challenged with CDV (Welter et al., 2000).
- Efficacy:
Both the NYVAC and attenuated CDV vaccines protected against the development of some clinical signs of infection. The results suggest that infant ferrets are less responsive to i.n. vaccination (Welter et al., 2000).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
78. PUREVAXFerret Distemper |
a. Tradename: |
PUREVAXFerret Distemper |
b. Manufacturer: |
Merial |
c. Vaccine Ontology ID: |
VO_0001159 |
d. Type: |
Recombinant vector vaccine |
e. Status: |
Licensed |
f. Immunization Route |
Intramuscular injection (i.m.) |
g. Description |
Canarypox virus-vectored vaccine |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
79. RECOMBITEK rDistemper |
a. Tradename: |
RECOMBITEK rDistemper |
b. Manufacturer: |
Merial |
c. Vaccine Ontology ID: |
VO_0001097 |
d. Type: |
Recombinant vector vaccine |
e. Status: |
Licensed |
f. Host Species for Licensed Use: |
Dog |
g. Immunization Route |
Intramuscular injection (i.m.) |
h. Description |
Canarypox virus-vectored vaccine (HA and F antigens) |
|
|
|
|
|
|
|
|
IV. References |
1. Fischer et al., 2002: Fischer L, Tronel JP, Pardo-David C, Tanner P, Colombet G, Minke J, Audonnet JC. Vaccination of puppies born to immune dams with a canine adenovirus-based vaccine protects against a canine distemper virus challenge. Vaccine. 2002; 20(29-30); 3485-3497. [PubMed: 12297394].
2. Jensen et al., 2009: Jensen TH, Nielsen L, Aasted B, Blixenkrone-Møller M. Early life DNA vaccination with the H gene of Canine distemper virus induces robust protection against distemper. Vaccine. 2009; 27(38); 5178-5183. [PubMed: 19596418].
3. Welter et al., 2000: Welter J, Taylor J, Tartaglia J, Paoletti E, Stephensen CB. Vaccination against canine distemper virus infection in infant ferrets with and without maternal antibody protection, using recombinant attenuated poxvirus vaccines. Journal of virology. 2000; 74(14); 6358-6367. [PubMed: 10864646].
4. Wiki: Canine distemper virus: Canine distemper virus [http://en.wikipedia.org/wiki/Canine_distemper_virus]
|