Marek's disease virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- MDV040
(Protective antigen)
- MDV095
(Protective antigen)
- Vaccine Information
- Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50)
- Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0)
- Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2)
- Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40)
- Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43)
- Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42)
- Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44)
- Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52)
- Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50)
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: )
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50)
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51)
- Fowl Laryngotracheitis-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16J1.R1)
- Fowl Laryngotracheitis-Marek's Disease Serotypes 2 & 3, Modified Live & Live Marek's Disease Vector Vaccine (USDA: 16J1.R2)
- Fowl Pox-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 15E2.00)
- Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.00)
- Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.04)
- Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.09)
- Marek's Disease Serotype 2, Live Virus Vaccine (USDA: 1631.00)
- Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.00)
- Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.01)
- Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.06)
- Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 16L1.06)
- Marek's Disease Serotypes 1 & 2 & 3, Live Virus Vaccine (USDA: 16L1.01)
- Marek's Disease Serotypes 1 & 3, Live Herpesvirus Chimera Vaccine (USDA: 1631.R0)
- Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16G1.02)
- Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.02)
- Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.08)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.00)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.01)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.02)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.05)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16G1.00)
- Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16L1.07)
- Marek's Disease Virus Vaccine rFPV/gB1
- Marek's Disease Virus Vaccine rFPV/gI
- Marek's Disease-Newcastle Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16N1.R0)
- Marek's Disease-Newcastle Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R2)
- Marek's Disease-Newcastle Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R1)
- Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R1)
- Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R2)
- Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00)
- Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03)
- Vaxxitek HVT+IBD
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10390 |
2. Disease: |
Marek's disease |
3. Introduction |
The causative agent of Marek’s disease. Gallid HV2 (Marek's disease virus)is highly contagious in chickens and induces T cell lymphomas in susceptible birds, causing annual losses to the worldwide poultry industry estimated at US$100 billion (Morrow and Fehler 2004). In the 100 years since Marek’s disease was first described, the disease has substantially increased in severity of symptoms. The first vaccines for gallid HV2 were developed in the late 1960’s and early 1970’s; but new, more virulent strains of the virus have emerged that are resistant to vaccine-induced immune responses (Nair 2005).
The virulence of gallid HV2 is expected to be a polygenic trait, with allelic variants at a number of loci playing a role (Shamblin et al. 2004). Thus, homologous recombination is expected to play an important role in the evolution of virulence, because it can bring together new mutations that originally evolved against different genetic backgrounds. DNA replication in alphaherpesviruses is recombination-dependent, providing a mechanism for homologous recombination between genetically distinct viruses infecting the same cell (Thiry et al. 2004). Sequence analysis has provided evidence of past homologous recombination events in several herpesviruses, including alphaherpesviruses (Bowden et al. 2004; Norberg et al. 2004; Peters et al. 2006) (Hughes and Rivailler, 2007). |
II. Vaccine Related Pathogen Genes |
1. MDV040 |
-
Gene Name :
MDV040
-
Sequence Strain (Species/Organism) :
Gallid alphaherpesvirus 2
-
VO ID :
VO_0011164
-
NCBI Gene ID :
4811501
-
NCBI Protein GI :
125745079
-
Locus Tag :
MD5V_040
-
Genbank Accession :
AF147806
-
Protein Accession :
YP_001033956
-
Taxonomy ID :
10390
-
Gene Starting Position :
61024
-
Gene Ending Position :
63651
-
Gene Strand (Orientation) :
-
-
Protein Name :
envelope glycoprotein B
-
Protein pI :
8.4
-
Protein Weight :
92434.87
-
Protein Length :
865
-
Protein Note :
glycoprotein BALF4; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA; BALF4 is a transmembrane glycoprotein found in the lipid envelope of several herpesviruses
-
DNA Sequence : Show Sequence
>NC_002229.3:61024-63651 Gallid herpesvirus 2, complete genome
TTTTATTCAGTTCAAATATAATAGTGCCCACTTACACAGCATCATCTTCTGAGTCTGAATATGTAGTAGG
TAACTTATCATATTTAGGGTTACTATTTTTAATCCTCATTTTTGCCAGGTGGTCCGATAGAACGGCGGTA
GTGCCTCGCCTCTTTCTCCGCAGTTTTTTCTCGTGGCGTTCTTCCGCGGAGACTAACGCCATATATTTTA
TCATTTCTCTAGCTTCTTCTAATTTTCTTTCATCAATAGATGTTCGTTCCAAATCATCTGATTCCTCGCC
ATGCAACTCACGCGTTGCCTGTGCCTTAAGCACTTCTGTTGTCATAGGATAAAGGGCTTTCATTGGATTG
CTTTTAAGCTTGTTTACATAACGATATGCTAAAAATGCAGCCACGAGTCCTGCTATAATGATTAAACCGA
TTGCCAAAGCCCCAAAGGGATTTGACATGAAAGCAGAGACACCAGATATGGTAGATACGATTGCACCGGC
AGCCCCTACTACAACTTTGCCTATAGCTTGCCCTACCTGACCCATACCGTTAAACAATTCGGCCAAACCG
TTCATAAACGCGTAATTTGTATCCACTTCTATTACTTTGTTTATGTCATAAAATTTAAGTTCATGTAGTT
GATTGCGGCGAGCTACTTCTGCATAATCCAATACACCAACATCACGCAACTCTTCTTTTGTGTAAACGGA
TAAAGGCAAAATTTCCCGATCTTCTAGCAGGGTTAGATTAAGCTCGACAAATGTGCTAGCAATCTGTATA
TCGGCAGCGTCTACCATCTTAACAAAATTATAGTTTTCAAATAAAGCATAACCGGATCCAAACAGAAAAT
ATCTACGATGATTAGCCGAGCATGGCTCTACAGCCTCTAGCGTTGGAAGCAACTCGTTGTTTTCACCGAG
TTGTCCCTGTATGTTTCCTTGGTTTTCTCCATATGAAAATAGAACCAATGGTCGGCTATAACATGTATTA
GTGGATGTGATAACTCGCATAGAATTTTGCAAAGTGACGGATTCCGCATCTATAGCAGTGCAGCTCGATA
CAGCAGCGACATCCCCCAACATCTTTGCAGCCACTCTCCTTCCTAATGTTGCACTCGCTGTAGCGCTAGG
ATTAATCTTTATCCCTTCGTGCCATAAAACAAGTTCTCTATTCTGCAATTCGCACCAAGCTGTGGCAATC
CTACTAAACATATCATTAATATGGGTTTGTATATGATCATAAAGAAATTGGAGCATGGCGAATTGAACAG
ACGATGTCGATTTAATAGCTGTGGTGTCGTCTAATGTTATTTTTCTATTTGGTGCATTTCGAATATCTCG
CCGCAATCGTGACAATGAGGTAGCATTTTTCTTATAAATTGCATGCTTATTGTTTACCAGGTCGAGCATC
TCATCGGTCCTGTTGTCTCTCATCAATTCTCTGAGGTACATATGAGCCAGGGATTTGGATAGAACAGGCT
GATATGCTACAATAAATCCCCCGAGAGCCAAGAAATATTGTACATGTCCAACCTTGACGTGACTGTCATT
ATATTTTGTCCTAAATATCTGCTCGATTGCTGCTTCTGCCTCGCGTTTAATACATTGTCCTAATATGATG
CGATTTGGATCAAACTCAGTCGTATTACTGATAAACGTTGCCGAAAGTTCACGGGCCATAAATCTGTATC
TCCCATTAACTGTTGCACGCAACATTTCAGTCACCTCTTTCCACTTAGTCATTGAACATACACGAGTAGT
TTTTGGAGCCCAGTCCCACCCAACTGTGAAGTGTGATGTGATGAGAAAGTTACGCTTGACTGGAAGGCTT
GCTTTTCGACGCTTGTCCAAATCCATTGAAAAATAGCTATCTAGTTGTTTGAAATTATCCTGGGGATATC
CCATGGGTTCTGCGGCAGCCTCTGGTGGGGATAGACCATAAAATGGAGATATGTTCGCGATGTCGCCATT
GGCCATTGCAAAATATGAATACGGAAACACAGAGCGGGCATCCATTTCCTCTACTATACAATTGACGGAG
GTTCCCGTTCGATATATCCATGGTGATCCCCACACGGTATACGTCTCATTAGTCGTGTGCCATGCCCTAG
ATTCGGGCGTGTTGAATTTTGATGGTTTTAGAAGTACTTGTTTTTCTCCCGCATCCCTGTCAAACGCTTC
AACATATACATTGTTTCTAAGGTATCTTGCTTTAGATGAGCATCTTCCTTTGCCGTCGATTAGATCCGTG
ATCTCTTCAATGGAAACGGGCGTCCTATCTGTATATCGATTAGTGATCTGTCTATATGTCGTCCCCGTCC
ATGTCGTCGTCTGAATGATATTTTTATAATAAAGCGTCACTTTAAATTTATATGGACTGATATTCTCTTT
AAATAATATCGCGATTCCTTCACCCCATTCGGTGGCTTTTCTAGGTTCGGGACATTTTCGCGGCGGTTCT
AGACGGATCACGGTTGAACCCACTGGTGGGGGACAAAGATAAAACGTAGACTCTTCCTCAGACAACTGGA
CGCTCGAAACAACTTCTCTTGATGTCACATTTTGGGTACTCGGAGATGAGTTCGTACCATATAGAATAAC
TATAAGGAAAAAAATGCAATTCCGCCTAAAATAGTGCA
-
Protein Sequence : Show Sequence
>YP_001033956.1 envelope glycoprotein B [Gallid alphaherpesvirus 2]
MHYFRRNCIFFLIVILYGTNSSPSTQNVTSREVVSSVQLSEEESTFYLCPPPVGSTVIRLEPPRKCPEPR
KATEWGEGIAILFKENISPYKFKVTLYYKNIIQTTTWTGTTYRQITNRYTDRTPVSIEEITDLIDGKGRC
SSKARYLRNNVYVEAFDRDAGEKQVLLKPSKFNTPESRAWHTTNETYTVWGSPWIYRTGTSVNCIVEEMD
ARSVFPYSYFAMANGDIANISPFYGLSPPEAAAEPMGYPQDNFKQLDSYFSMDLDKRRKASLPVKRNFLI
TSHFTVGWDWAPKTTRVCSMTKWKEVTEMLRATVNGRYRFMARELSATFISNTTEFDPNRIILGQCIKRE
AEAAIEQIFRTKYNDSHVKVGHVQYFLALGGFIVAYQPVLSKSLAHMYLRELMRDNRTDEMLDLVNNKHA
IYKKNATSLSRLRRDIRNAPNRKITLDDTTAIKSTSSVQFAMLQFLYDHIQTHINDMFSRIATAWCELQN
RELVLWHEGIKINPSATASATLGRRVAAKMLGDVAAVSSCTAIDAESVTLQNSMRVITSTNTCYSRPLVL
FSYGENQGNIQGQLGENNELLPTLEAVEPCSANHRRYFLFGSGYALFENYNFVKMVDAADIQIASTFVEL
NLTLLEDREILPLSVYTKEELRDVGVLDYAEVARRNQLHELKFYDINKVIEVDTNYAFMNGLAELFNGMG
QVGQAIGKVVVGAAGAIVSTISGVSAFMSNPFGALAIGLIIIAGLVAAFLAYRYVNKLKSNPMKALYPMT
TEVLKAQATRELHGEESDDLERTSIDERKLEEAREMIKYMALVSAEERHEKKLRRKRRGTTAVLSDHLAK
MRIKNSNPKYDKLPTTYSDSEDDAV
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV, Gallid herpesvirus 2). rFPV/gB1 expressing MDV040 conferred 42% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003).
- Related Vaccine(s):
Marek's Disease Virus Vaccine rFPV/gB1
|
2. MDV095 |
-
Gene Name :
MDV095
-
Sequence Strain (Species/Organism) :
Gallid alphaherpesvirus 2
-
VO ID :
VO_0011165
-
NCBI Gene ID :
4811454
-
NCBI Protein GI :
125745128
-
Locus Tag :
MD5V_095
-
Genbank Accession :
AF243438
-
Protein Accession :
YP_001034012
-
Taxonomy ID :
10390
-
Gene Starting Position :
161182
-
Gene Ending Position :
164094
-
Gene Strand (Orientation) :
+
-
Protein Name :
envelope glycoprotein I
-
Protein pI :
6.7
-
Protein Weight :
37988.3
-
Protein Length :
355
-
Protein Note :
envelope glycoprotein I; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; envelope glycoprotein E and glycoprotein I form a heterodimer that play important roles in virus cell-to-cell spread
-
DNA Sequence : Show Sequence
>NC_002229.3:161182-164094 Gallid herpesvirus 2, complete genome
GATGTATCTACTACAATTATTATTTTGGATCCGCCTCTTTCGAGGCATCTGGTCTATAGTTTATACTGGA
ACATCTGTTACGTTATCAACGGACCAATCTGCTCTTGTTGCGTTCTGCGGATTAGATAAAATGGTGAATG
TACGCGGCCAACTTTTATTCCTGGGCGACCAGACTCGGACCAGTTCTTATACAGGAACGACGGAAATCTT
GAAATGGGATGAAGAATATAAATGCTATTCCGTTCTACATGCGACATCATATATGGATTGTCCTGCTATA
GACGCCACGGTATTCAGAGGCTGTAGAGACGCTGTGGTATATGCTCAACCTCATGATAGAGTACAACCTT
TTCCCGAAAAGGGAACATTGTTGAGAATTGTCGAACCCAGAGTATCAGATACAGGCAGCTATTACATACG
TGTAGCTCTCGCTGGAAGAAATATGAGCGATATATTTAGAATGGCTGTTATTATAAGGAGTAGCAAATCT
TGGGCCTGTAATCACTCTGCTAGTTCATTTCAGGCCCATAAATGTATTCGCTATGTCGACCGTATGGCCT
TTGAAAATTATCTGATTGGACATGTAGGCAATTTGCTGGACAGTGACTCGGAATTGCATGCAATTTATAA
TATTACTCCCCAATCCATTTCCACAGATATTAATATTATAACGACTCCATTTTACGATAATTCGGGAACA
ATTTATTCACCTACGGTTTTTAATTTGTTTAATAACAATTCCCATGTCGATGCAATGAATTCGACTGGTA
TGTGGAATACCGTTTTAAAATATACCCTTCCAAGGCTTATTTACTTTTCTACGATGATTGTACTATGTAT
AATAGCATTGGCAATTTATTTGGTCTGTGAAAGGTGCCGCTCTCCCCATCGTAGGATATACATCGGTGAA
CCAAGATCTGATGAGGCCCCACTCATCACTTCTGCAGTTAACGAATCATTTCAATATGATTATAATGTAA
AGGAAACTCCTTCAGATGTTATTGAAAAGGAGTTGATGGAAAAACTGAAGAAGAAAGTCGAATTGTTGGA
AAGAGAAGAATGTGTATAGGTTTGAGAAACTATTATAGGTAGGTGGTACCTGTTAGCTTAGTATAAGGGG
AGGAGCCGTTTCTTGTTTTAAAGACACGAACACAAGGCAGTAAGTTTTATATGTGAATTTTGTGCATGTC
TGCGAGTCAGCGTCATAATGTGTGTTTTCCAAATCCTGATAATAGTGACGACGATCAAAGTAGCTGGAAC
GGCCAACATAAATCATATAGACGTTCCTGCAGGACATTCTGCTACAACGACGATCCCGCGATATCCACCA
GTTGTCGATGGGACCCTTTACACCGAGACGTGGACATGGATTCCCAATCACTGCAACGAAACGGCAACAG
GCTATGTATGTCTGGAAAGTGCTCACTGTTTTACCGATTTGATATTAGGAGTATCCTGCATGAGGTATGC
GGATGAAATCGTCTTACGAACTGATAAATTTATTGTCGATGCGGGATCCATTAAACAAATAGAATCGCTA
AGTCTGAATGGAGTTCCGAATATATTCCTATCTACGAAAGCAAGTAACAAGTTGGAGATACTAAATGCTA
GCCTACAAAATGCGGGTATCTACATTCGGTATTCTAGAAATGGGACGAGGACTGCAAAGCTGGATGTTGT
TGTGGTTGGCGTTTTGGGTCAAGCAAGGGATCGCCTACCCCAAATGTCCAGTCCTATGATCTCATCCCAC
GCCGATATCAAGTTGTCATTAAAAAACTTTAAAGCATTAGTATATCACGTGGGAGATACTATCAATGTCT
CGACGGCGGTTATACTAGGACCTTCTCCGGAGATATTCACATTGGAATTTAGGGTGTTGTTCCTCCGTTA
TAATCCAACGTGCAAGTTCGTCACGATTTATGAACCTTGTATATTTCACCCCAAAGAACCAGAGTGTATT
ACTACTGCAGAACAATCGGTATGTCATTTCGCATCCAACATTGACATTCTGCAGATAGCCGCCGCACGTT
CTGAAAATTGTAGCACAGGGTATCGTAGATGTATTTATGACACGGCTATCGATGAATCTGTGCAGGCCAG
ATTAACATTCATAGAACCAGGAATTCCTTCCTTTAAAATGAAAGATGTCCAGGTAGACGATGCTGGATTG
TATGTGGTTGTGGCTTTATACAATGGACGTCCAAGTGCATGGACTTACATTTATTTGTCAACGGTGGAAA
CATATCTTAATGTATATGAAAACTACCACAAGCCGGGATTTGGGTATAAATCATTTCTACAGAACAGTAG
TATCGTCGACGAAAATGAGGCTAGCGATTGGTCCAGCTCGTCCATTAAACGGAGAAATAATGGTACTATC
ATTTATGATATTTTACTCACATCGCTATCAATTGGGGCGATTATTATCGTCATAGTAGGGGGTGTTTGTA
TTGCCATATTAATTAGGCGTAGGAGACGACGTCGCACGAGGGGGTTATTCGATGAATATCCCAAATATAT
GACGCTACCAGGAAACGATCTGGGGGGCATGAATGTACCGTATGATAATACATGCTCTGGTAACCAAGTT
GAATATTATCAAGAAAAGTCGGCTAAAATGAAAAGAATGGGTTCGGGTTATACCGCTTGGCTAAAAAATG
ATATGCCGAAAATTAGGAAACGCTTAGATTTATACCACTGATATGTACATATTTAAACTTAATGGGATAT
AGTATATGGACGTCTATATGACGAGAGTAAATAAACTGACACTGCAAATGAAGCTGATCTATATTGTGCT
TTATATTGGGACAAACCACTCGCACAAGCTCATTCAACACATCCACTCTTGCTATTAAATTCCCCATTAT
ATAACAATACTGACATAACACTCATATTAAGGGGAGAAAATAA
-
Protein Sequence : Show Sequence
>YP_001034012.1 envelope glycoprotein I [Gallid alphaherpesvirus 2]
MYLLQLLFWIRLFRGIWSIVYTGTSVTLSTDQSALVAFCGLDKMVNVRGQLLFLGDQTRTSSYTGTTEIL
KWDEEYKCYSVLHATSYMDCPAIDATVFRGCRDAVVYAQPHDRVQPFPEKGTLLRIVEPRVSDTGSYYIR
VALAGRNMSDIFRMAVIIRSSKSWACNHSASSFQAHKCIRYVDRMAFENYLIGHVGNLLDSDSELHAIYN
ITPQSISTDINIITTPFYDNSGTIYSPTVFNLFNNNSHVDAMNSTGMWNTVLKYTLPRLIYFSTMIVLCI
IALAIYLVCERCRSPHRRIYIGEPRSDEAPLITSAVNESFQYDYNVKETPSDVIEKELMEKLKKKVELLE
REECV
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV, Gallid herpesvirus 2). rFPV/gI expressing MDV095 conferred 43% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003).
- Related Vaccine(s):
Marek's Disease Virus Vaccine rFPV/gI
|
III. Vaccine Information |
|
|
|
|
|
|
1. Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0) |
a. Manufacturer: |
Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002197 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002043 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002047 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002196 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002040 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002041 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002044 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002045 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002046 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002200 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002198 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002199 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002051 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002053 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002052 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002054 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002050 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002042 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: ) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002031 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002048 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002049 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Fowl Laryngotracheitis-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16J1.R1) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002141 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Fowl Laryngotracheitis-Marek's Disease Serotypes 2 & 3, Modified Live & Live Marek's Disease Vector Vaccine (USDA: 16J1.R2) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002142 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Fowl Pox-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 15E2.00) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002140 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.00) |
a. Manufacturer: |
Intervet Inc., Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0001683 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.04) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001684 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Marek's Disease Serotype 1, Live Virus Vaccine (USDA: 16L1.09) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001685 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Marek's Disease Serotype 2, Live Virus Vaccine (USDA: 1631.00) |
a. Manufacturer: |
Intervet Inc., Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0001686 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.00) |
a. Manufacturer: |
Wyeth, Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001687 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.01) |
a. Manufacturer: |
Wyeth, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001688 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1641.06) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001689 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 16L1.06) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0001690 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Marek's Disease Serotypes 1 & 2 & 3, Live Virus Vaccine (USDA: 16L1.01) |
a. Manufacturer: |
Intervet Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0001691 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Marek's Disease Serotypes 1 & 3, Live Herpesvirus Chimera Vaccine (USDA: 1631.R0) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001692 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16G1.02) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001693 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.02) |
a. Manufacturer: |
Intervet Inc., Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0001694 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Marek's Disease Serotypes 1 & 3, Live Virus Vaccine (USDA: 16L1.08) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001695 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.00) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001696 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.01) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001697 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.02) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001698 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1651.05) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001699 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16G1.00) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001700 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 16L1.07) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0001701 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
44. Marek's Disease Virus Vaccine rFPV/gB1 |
a. Vaccine Ontology ID: |
VO_0011393 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Gene Engineering of
MDV040 |
- Type:
Recombinant vector construction
- Description:
- Detailed Gene Information: Click here.
|
e. Vector: |
Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV) coding for glycoprotein B1 (gB1) (Lee et al., 2003). |
f. Immunization Route |
wing web (ww) and intra-abdominal (i.a.) routes |
g.
Chicken Response |
- Vaccination Protocol:
Groups of 17 chickens were vaccinated at 1 day of age with variable dosage from 10^1 to 10^6 plaque-forming units (PFU) of rFPV vaccines by both the wing web (ww) and intra-abdominal (i.a.) routes in trial 1. Monovalent vaccines of either SB-1 or HVT were administered to chickens by the i.a. route at a dose of 2000 PFU. For rFPV + MDV vaccines, each component was administered by a separate inoculation. The ab+ chickens were used in all the experiments (Lee et al., 2003).
- Challenge Protocol:
At 6 days posthatch, groups of vaccinated and unvaccinated chickens were challenged by i.a. inoculation of 500 PFU of strain Md5. Mortality during the course of the experiment was recorded, and chickens were examined for gross MD lesions (Lee et al., 2003).
- Efficacy:
rFPV/gB1 expressing MDV040 conferred 42% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
45. Marek's Disease Virus Vaccine rFPV/gI |
a. Vaccine Ontology ID: |
VO_0011392 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Gene Engineering of
MDV095 |
- Type:
Recombinant vector construction
- Description:
- Detailed Gene Information: Click here.
|
e. Vector: |
Recombinant fowl poxviruses (rFPVs) were constructed to express genes from serotype 1 Marek's disease virus (MDV) coding for glycoprotein I (gI). |
f. Immunization Route |
wing web (ww) and intra-abdominal (i.a.) routes |
g.
Chicken Response |
- Vaccination Protocol:
Groups of 17 chickens were vaccinated at 1 day of age with variable dosage from 10^1 to 10^6 plaque-forming units (PFU) of rFPV vaccines by both the wing web (ww) and intra-abdominal (i.a.) routes in trial 1. Monovalent vaccines of either SB-1 or HVT were administered to chickens by the i.a. route at a dose of 2000 PFU. For rFPV + MDV vaccines, each component was administered by a separate inoculation. The ab+ chickens were used in all the experiments (Lee et al., 2003).
- Challenge Protocol:
At 6 days posthatch, groups of vaccinated and unvaccinated chickens were challenged by i.a. inoculation of 500 PFU of strain Md5. Mortality during the course of the experiment was recorded, and chickens were examined for gross MD lesions (Lee et al., 2003).
- Efficacy:
rFPV/gI expressing MDV095 conferred 43% protection in maternal antibody-positive chickens when challenged with highly virulent MDV isolates (Lee et al., 2003).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46. Marek's Disease-Newcastle Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 16N1.R0) |
a. Manufacturer: |
Intervet Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002143 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
47. Marek's Disease-Newcastle Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R2) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002145 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
48. Marek's Disease-Newcastle Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 16N1.R1) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002144 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
49. Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R1) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002182 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
50. Marek's Disease-Newcastle Disease Serotypes 2 & 3, Live Virus & Live Marek's Disease Vector Vaccine (USDA: 17H1.R2) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002183 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
51. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002146 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
52. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002147 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
53. Vaxxitek HVT+IBD |
a. Tradename: |
Vaxxitek HVT+IBD |
b. Manufacturer: |
Merial |
c. Vaccine Ontology ID: |
VO_0011473 |
d. Type: |
Live, attenuated vaccine |
e. Status: |
Licensed |
f. Host Species for Licensed Use: |
Pig |
g. Immunization Route |
Intramuscular injection (i.m.) |
h. Description |
Live recombinant chimera virus expressing VP2 gene of IBD on HTV virus(Darteil et al., 1995) |
|
|
|
|
|
|
|
|
IV. References |
1. Darteil et al., 1995: Darteil R, Bublot M, Laplace E, Bouquet JF, Audonnet JC, Rivière M. Herpesvirus of turkey recombinant viruses expressing infectious bursal disease virus (IBDV) VP2 immunogen induce protection against an IBDV virulent challenge in chickens. Virology. 1995; 211(2); 481-490. [PubMed: 7645252].
2. Hughes and Rivailler, 2007: Hughes AL, Rivailler P. Phylogeny and recombination history of gallid herpesvirus 2 (Marek's disease virus) genomes. Virus research. 2007; 130(1-2); 28-33. [PubMed: 17566585].
3. Lee et al., 2003: Lee LE, Witter RL, Reddy SM, Wu P, Yanagida N, Yoshida S. Protection and synergism by recombinant fowl pox vaccines expressing multiple genes from Marek's disease virus. Avian diseases. 2003; 47(3); 549-558. [PubMed: 14562881].
|