VIOLIN: Vaccine Investigation and Online Information Network

SARS-CoV-2

Table of Contents

General Information
1. NCBI Taxonomy ID
2. Disease
Vaccine Related Pathogen Genes
1. envelope (E) protein (Protective antigen)
2. spike (S) protein (Protective antigen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

2697049

2. Disease:

COVID-19

II. Vaccine Related Pathogen Genes

1. envelope (E) protein

Gene Name : envelope (E) protein
Sequence Strain (Species/Organism) : Severe acute respiratory syndrome coronavirus 2
NCBI Gene ID : 43740570
NCBI Protein GI : 1796318600
Locus Tag : GU280_gp04
Genbank Accession : LC528232
Protein Accession : YP_009724392
Taxonomy ID : 2697049
Gene Starting Position : 26244
Gene Ending Position : 26471
Gene Strand (Orientation) : +
Protein Name : envelope protein
Protein pI : 8.48
Protein Weight : 7075.68
Protein Length : 75
Protein Note : ORF4; structural protein; E protein

DNA Sequence : Show Sequence

>NC_045512.2:26244-26471 Severe acute respiratory syndrome coronavirus 2 isolate Wuhan-Hu-1, complete genome
TATGTACTCATTCGTTTCGGAAGAGACAGGTACGTTAATAGTTAATAGCGTACTTCTTTTTCTTGCTTTC
GTGGTATTCTTGCTAGTTACACTAGCCATCCTTACTGCGCTTCGATTGTGTGCGTACTGCTGCAATATTG
TTAACGTGAGTCTTGTAAAACCTTCTTTTTACGTTTACTCTCGTGTTAAAAATCTGAATTCTTCTAGAGT
TCCTGATCTTCTGGTCTA

Protein Sequence : Show Sequence

>YP_009724392.1 envelope protein [Severe acute respiratory syndrome coronavirus 2]
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRV
PDLLV

Molecule Role : Protective antigen

2. spike (S) protein

Gene Name : spike (S) protein
Sequence Strain (Species/Organism) : Severe acute respiratory syndrome coronavirus 2
VO ID : PR_P0DTC2
NCBI Gene ID : 43740568
NCBI Protein GI : 1796318598
Locus Tag : GU280_gp02
Genbank Accession : LC528232
Protein Accession : YP_009724390
Taxonomy ID : 2697049
Gene Starting Position : 21562
Gene Ending Position : 25383
Gene Strand (Orientation) : +
Protein Name : surface glycoprotein
Protein pI : 6.62
Protein Weight : 131552.24
Protein Length : 1273
Protein Note : Also known as spike glycoproteinstructural protein; spike protein

DNA Sequence : Show Sequence

>NC_045512.2:21562-25383 Severe acute respiratory syndrome coronavirus 2 isolate Wuhan-Hu-1, complete genome
AATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTACAACCAGAACTCAA
TTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTTTATTACCCTGACAAAGTTTTCAGATCCTCAG
TTTTACATTCAACTCAGGACTTGTTCTTACCTTTCTTTTCCAATGTTACTTGGTTCCATGCTATACATGT
CTCTGGGACCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTTTATTTTGCT
TCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTACTACTTTAGATTCGAAGACCCAGTCCC
TACTTATTGTTAATAACGCTACTAATGTTGTTATTAAAGTCTGTGAATTTCAATTTTGTAATGATCCATT
TTTGGGTGTTTATTACCACAAAAACAACAAAAGTTGGATGGAAAGTGAGTTCAGAGTTTATTCTAGTGCG
AATAATTGCACTTTTGAATATGTCTCTCAGCCTTTTCTTATGGACCTTGAAGGAAAACAGGGTAATTTCA
AAAATCTTAGGGAATTTGTGTTTAAGAATATTGATGGTTATTTTAAAATATATTCTAAGCACACGCCTAT
TAATTTAGTGCGTGATCTCCCTCAGGGTTTTTCGGCTTTAGAACCATTGGTAGATTTGCCAATAGGTATT
AACATCACTAGGTTTCAAACTTTACTTGCTTTACATAGAAGTTATTTGACTCCTGGTGATTCTTCTTCAG
GTTGGACAGCTGGTGCTGCAGCTTATTATGTGGGTTATCTTCAACCTAGGACTTTTCTATTAAAATATAA
TGAAAATGGAACCATTACAGATGCTGTAGACTGTGCACTTGACCCTCTCTCAGAAACAAAGTGTACGTTG
AAATCCTTCACTGTAGAAAAAGGAATCTATCAAACTTCTAACTTTAGAGTCCAACCAACAGAATCTATTG
TTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGTGAAGTTTTTAACGCCACCAGATTTGCATCTGT
TTATGCTTGGAACAGGAAGAGAATCAGCAACTGTGTTGCTGATTATTCTGTCCTATATAATTCCGCATCA
TTTTCCACTTTTAAGTGTTATGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTACTAATGTCTATG
CAGATTCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCGCTCCAGGGCAAACTGGAAAGATTGCTGA
TTATAATTATAAATTACCAGATGATTTTACAGGCTGCGTTATAGCTTGGAATTCTAACAATCTTGATTCT
AAGGTTGGTGGTAATTATAATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTTGAGAGAG
ATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTTAATTGTTACTT
TCCTTTACAATCATATGGTTTCCAACCCACTAATGGTGTTGGTTACCAACCATACAGAGTAGTAGTACTT
TCTTTTGAACTTCTACATGCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAAAACA
AATGTGTCAATTTCAACTTCAATGGTTTAACAGGCACAGGTGTTCTTACTGAGTCTAACAAAAAGTTTCT
GCCTTTCCAACAATTTGGCAGAGACATTGCTGACACTACTGATGCTGTCCGTGATCCACAGACACTTGAG
ATTCTTGACATTACACCATGTTCTTTTGGTGGTGTCAGTGTTATAACACCAGGAACAAATACTTCTAACC
AGGTTGCTGTTCTTTATCAGGATGTTAACTGCACAGAAGTCCCTGTTGCTATTCATGCAGATCAACTTAC
TCCTACTTGGCGTGTTTATTCTACAGGTTCTAATGTTTTTCAAACACGTGCAGGCTGTTTAATAGGGGCT
GAACATGTCAACAACTCATATGAGTGTGACATACCCATTGGTGCAGGTATATGCGCTAGTTATCAGACTC
AGACTAATTCTCCTCGGCGGGCACGTAGTGTAGCTAGTCAATCCATCATTGCCTACACTATGTCACTTGG
TGCAGAAAATTCAGTTGCTTACTCTAATAACTCTATTGCCATACCCACAAATTTTACTATTAGTGTTACC
ACAGAAATTCTACCAGTGTCTATGACCAAGACATCAGTAGATTGTACAATGTACATTTGTGGTGATTCAA
CTGAATGCAGCAATCTTTTGTTGCAATATGGCAGTTTTTGTACACAATTAAACCGTGCTTTAACTGGAAT
AGCTGTTGAACAAGACAAAAACACCCAAGAAGTTTTTGCACAAGTCAAACAAATTTACAAAACACCACCA
ATTAAAGATTTTGGTGGTTTTAATTTTTCACAAATATTACCAGATCCATCAAAACCAAGCAAGAGGTCAT
TTATTGAAGATCTACTTTTCAACAAAGTGACACTTGCAGATGCTGGCTTCATCAAACAATATGGTGATTG
CCTTGGTGATATTGCTGCTAGAGACCTCATTTGTGCACAAAAGTTTAACGGCCTTACTGTTTTGCCACCT
TTGCTCACAGATGAAATGATTGCTCAATACACTTCTGCACTGTTAGCGGGTACAATCACTTCTGGTTGGA
CCTTTGGTGCAGGTGCTGCATTACAAATACCATTTGCTATGCAAATGGCTTATAGGTTTAATGGTATTGG
AGTTACACAGAATGTTCTCTATGAGAACCAAAAATTGATTGCCAACCAATTTAATAGTGCTATTGGCAAA
ATTCAAGACTCACTTTCTTCCACAGCAAGTGCACTTGGAAAACTTCAAGATGTGGTCAACCAAAATGCAC
AAGCTTTAAACACGCTTGTTAAACAACTTAGCTCCAATTTTGGTGCAATTTCAAGTGTTTTAAATGATAT
CCTTTCACGTCTTGACAAAGTTGAGGCTGAAGTGCAAATTGATAGGTTGATCACAGGCAGACTTCAAAGT
TTGCAGACATATGTGACTCAACAATTAATTAGAGCTGCAGAAATCAGAGCTTCTGCTAATCTTGCTGCTA
CTAAAATGTCAGAGTGTGTACTTGGACAATCAAAAAGAGTTGATTTTTGTGGAAAGGGCTATCATCTTAT
GTCCTTCCCTCAGTCAGCACCTCATGGTGTAGTCTTCTTGCATGTGACTTATGTCCCTGCACAAGAAAAG
AACTTCACAACTGCTCCTGCCATTTGTCATGATGGAAAAGCACACTTTCCTCGTGAAGGTGTCTTTGTTT
CAAATGGCACACACTGGTTTGTAACACAAAGGAATTTTTATGAACCACAAATCATTACTACAGACAACAC
ATTTGTGTCTGGTAACTGTGATGTTGTAATAGGAATTGTCAACAACACAGTTTATGATCCTTTGCAACCT
GAATTAGACTCATTCAAGGAGGAGTTAGATAAATATTTTAAGAATCATACATCACCAGATGTTGATTTAG
GTGACATCTCTGGCATTAATGCTTCAGTTGTAAACATTCAAAAAGAAATTGACCGCCTCAATGAGGTTGC
CAAGAATTTAAATGAATCTCTCATCGATCTCCAAGAACTTGGAAAGTATGAGCAGTATATAAAATGGCCA
TGGTACATTTGGCTAGGTTTTATAGCTGGCTTGATTGCCATAGTAATGGTGACAATTATGCTTTGCTGTA
TGACCAGTTGCTGTAGTTGTCTCAAGGGCTGTTGTTCTTGTGGATCCTGCTGCAAATTTGATGAAGACGA
CTCTGAGCCAGTGCTCAAAGGAGTCAAATTACATTACACATA

Protein Sequence : Show Sequence

>YP_009724390.1 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2]
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHV
SGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPF
LGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPI
NLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYN
ENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV
YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYF
PLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLT
PTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG
AENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGI
AVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIG
VTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDI
LSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM
SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVA
KNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
SEPVLKGVKLHYT

Molecule Role : Protective antigen
Related Vaccine(s): Johnson & Johnson COVID-19 vaccine , SARS-CoV-2 Vaccine YF-S0

III. Vaccine Information

1. 202-CoV

a. Manufacturer:

Shanghai Zerun Biotechnology, Walvax Biotechnology, CEPI

b. Vaccine Ontology ID:

VO_0005320

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

2. AAHI-SC2

a. Manufacturer:

ImmunityBio, Inc.

b. Vaccine Ontology ID:

VO_0005405

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

3. AAV5-RBD-S

a. Manufacturer:

Biocad

b. Vaccine Ontology ID:

VO_0005336

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

4. Abdala

a. Product Name:

CIGB-66

b. Manufacturer:

Center for Genetic Engineering and Biotechnology

c. Vaccine Ontology ID:

VO_0005082

d. Type:

Subunit vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

5. ABNCoV2

a. Product Name:

COUGH-1

b. Manufacturer:

AdaptVac, Bavarian Nordic, and Radboud University

c. Vaccine Ontology ID:

VO_0005255

d. Type:

Virus like particle

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

capsid virus-like particle (cVLP) +/- adjuvant MF59

6. ABO1009-DP

a. Manufacturer:

Suzhou Abogen Biosciences Co., Ltd.

b. Vaccine Ontology ID:

VO_0005391

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

7. ACM-001

a. Manufacturer:

ACM Biolabs

b. Vaccine Ontology ID:

VO_0005392

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

8. Ad5-nCoV

a. Tradename:

Convidecia, PakVak

b. Manufacturer:

CanSino Biologics

c. Vaccine Ontology ID:

VO_0005144

d. Type:

Recombinant vector vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Antigen

SARS-CoV-2 spike protein (Zhu et al., 2020)

h. Vector:

Adenovirus type 5 (Zha, et al., 2020)

i. Immunization Route

Intramuscular injection (i.m.)

j. Human Response

Vaccination Protocol: Patients were immunized with 5 × 10e10 viral particles per 0·5 mL (low dose), 1 × 10e11 viral particles per mL (middle dose), or 1.5 × 10e11 viral particles per 1·5 mL (high dose). (Zhu et al., 2020)
Immune Response: Anti-RBD antibodies detected at day 14. NAb titers peaked at day 28. TNF-α levels from CD8+ cells were highest in the high dose group. IFN-γ, IL-2 and TNF-α were detected in all groups. (Zhu et al., 2020)

9. Ad5-triCoV/Mac

a. Manufacturer:

McMaster University

b. Vaccine Ontology ID:

VO_0005339

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

S1 region of SARS-CoV-2 spike protein (aa 47-716) and full-length SARS-CoV-2 nucleoprotein (N) fused to a highly conserved portion of the SARS-CoV-2 polymerase (RdRp or POL)

g. Vector:

recombinant type 5 replication deficient human adenovirus vector

h. Immunization Route

intranasal immunization

10. AdCLD-CoV19

a. Manufacturer:

Cellid Co., Ltd.

b. Vaccine Ontology ID:

VO_0004996

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

11. AdimrSC-2f

a. Manufacturer:

Adimmune Corp.

b. Vaccine Ontology ID:

VO_0005173

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

12. AG0301-COVID19

a. Manufacturer:

AnGes, Inc.

b. Vaccine Ontology ID:

VO_0005165

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

spike (S) glycoprotein

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

A SARS-CoV-2 DNA vaccine

13. AG0302-COVID19

a. Manufacturer:

AnGes, Inc.

b. Vaccine Ontology ID:

VO_0005322

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Immune Response: A cellular immune response was observed in some subjects after AG0302-COVID19 intradermal inoculation (Nakagami et al,, 2022)
Description: AG0302-COVID19 is under clinical trial now (NCT04655625; Nakagami et al,, 2022)

Phase II/III: NCT04655625
Age subgroups: 18 years and above
Location: Japan

14. AKS-452

a. Manufacturer:

University Medical Center Groningen, Akston Biosciences Inc.

b. Vaccine Ontology ID:

VO_0004999

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

15. Almansour-001

a. Manufacturer:

Imam Abdulrahman Bin Faisal University

b. Vaccine Ontology ID:

VO_0005393

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

16. ARCoV

a. Manufacturer:

Academy of Military Science (AMS), Walvax Biotechnology, Suzhou Abogen Biosciences

b. Vaccine Ontology ID:

VO_0005161

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Host Species as Laboratory Animal Model:

mouse, cynomolgus monkeys

g. Antigen

RBD domain of S protein (Zha, et al., 2020)

h. Vector:

Lipid nanoparticles (Zha, et al., 2020)

i. Immunization Route

Intramuscular injection (i.m.)

j. Storage

After treament can store

k. Description

A SARS-CoV-2 mRNA vaccine made of lipid nanoparticle-encapsulated mRNA (mRNA-LNP) encoding the receptor binding domain (RBD) of SARS-CoV-2
(Zha, et al., 2020)

l. Macaque Response

Vaccination Protocol: Two groups of macaques (n = 10/group) were immunized with 100 or 1,000 μg of ARCoV mRNA-LNP via i.m. administration and boosted with the same dose 14 days after initial immunization. The same number of monkeys (n = 10) was vaccinated with PBS as a placebo. (Zhang et al., 2020)
Immune Response: specific IgG antibodies were readily induced on day 14 after initial immunization, and the booster immunization resulted in a notable increase in IgG titers to ∼1/5,210 and ∼1/22,085 on day 28 after initial immunization. Fifty percent of animals that received high-dose ARCoV immunization developed low-level neutralizing antibodies on day 14 after initial immunization, whereas the booster immunization resulted in a notable increase in NT50 to ∼1/699 and ∼1/6,482 in monkeys vaccinated with low- or high-dose ARCoV, respectively. SARS-CoV-2 RBD-specific T cell responses were stimulated in peripheral blood monocytes (PBMCs) from monkeys vaccinated with a low or high dose of ARCoV on day 5 after booster immunization but not from animals receiving a placebo. There was no significant difference in IL-4+/CD4+ cell response to the SARS-CoV-2 RBD between ARCoV- and placebo-treated animals, suggesting induction of a Th1-biased cellular immune response by ARCoV immunization. (Zhang et al., 2020)

m. Mouse Response

Vaccination Protocol: Female BALB/c mice were immunized i.m. with 2 μg (n = 8) or 10 μg (n = 8) of ARCoV or a placebo (n = 5) and boosted with an equivalent dose 14 days later. Serum was collected 7, 14, 21, and 28 days after initial vaccination. (Zhang et al., 2020)
Immune Response: Remarkably, a second immunization with 2 or 10 μg of ARCoV mRNA-LNP resulted in rapid elevation of immunoglobulin G (IgG) and neutralizing antibodies in mice, whereas no SARS-CoV-2-specific IgG and neutralizing antibodies were detected in sera from mice vaccinated with empty LNPs. 28 days after initial immunization, the NT50 titers in mice immunized with 2 or 10 μg of ARCoV mRNA-LNP approached ∼1/2,540 and ∼1/7,079, respectively, and the PRNT50 reached ∼1/2,194 and ∼1/5,704, respectively. (Zhang et al., 2020)
There was a significant increase in virus-specific CD4+ and CD8+ effector memory T (Tem) cells in splenocytes from ARCoV-vaccinated mice in comparison with placebo LNPs (Figure 4 A) upon stimulation with peptide pools covering the SARS-CoV-2 RBD. Secretion of interferon γ (IFN-γ), tumor necrosis factor alpha (TNF-α), and interleukin-2 (IL-2) in splenocytes from mRNA-LNP-immunized mice was significantly higher than in those that received the placebo vaccination. There was no significant difference in IL-4 and IL-6 secretion between ARCoV-immunized animals and placebo-immunized ones, demonstrating that the mRNA-LNP vaccine successfully induces a Th1-biased, SARS-CoV-specific cellular immune response. (Zhang et al., 2020)
Challenge Protocol: Mice that received two doses of immunization of ARCoV mRNA-LNP at 2 or 10 μg were challenged i.n. with 6,000 plaque-forming units (PFUs) of SARS-CoV-2 MASCp6 40 days after initial vaccination. (Zhang et al., 2020)
Efficacy: All mice immunized with 2 or 10 μg of ARCoV mRNA-LNP showed full protection against SARS-CoV-2 infection, and no measurable viral RNA was detected in the lungs and trachea , whereas high levels of viral RNA were detected in the lungs and trachea (∼109 and 107 RNA copy equivalents per gram, respectively) of mice in the placebo group. (Zhang et al., 2020)

17. ARCT-021

a. Product Name:

LUNAR-COV19

b. Vaccine Ontology ID:

VO_0005164

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

spike (S) protein gene (Saha et al., 2020)

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

A SARS-CoV-2 investigational vaccine comprising a self-replicating (replicon) mRNA that encodes for the prefusion spike protein of 2019-nCoV formulated in a lipid nanoparticle (Saha et al., 2020)

18. ARCT-154

a. Manufacturer:

Arcturus Therapeutics, Inc.

b. Vaccine Ontology ID:

VO_0005331

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

19. ARCT-165

a. Manufacturer:

Arcturus Therapeutics, Inc.

b. Vaccine Ontology ID:

VO_0005332

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

20. AV-COVID-19

a. Manufacturer:

Aivita Biomedical, Inc.

b. Vaccine Ontology ID:

VO_0005079

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

21. AZD2816

a. Manufacturer:

AstraZeneca, University of Oxford

b. Vaccine Ontology ID:

VO_0005319

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

22. bacTRL-Spike

a. Manufacturer:

Symvivo

b. Vaccine Ontology ID:

VO_0005174

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Oral

23. Baiya SARS-CoV-2 Vax 1

a. Manufacturer:

Baiya Phytopharm Co., Ltd.

b. Vaccine Ontology ID:

VO_0005317

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

24. BBIBP-CorV

a. Manufacturer:

Beijing Institute of Biological Products, Sinopharm

b. Vaccine Ontology ID:

VO_0005167

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

whole virus

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

An inactivated whole virus vaccine produced in Vero cells.

i. Macaque Response

Vaccination Protocol: All macaques were immunized twice on days 0 (D0) and 14 (D14). The placebo group was intramuscularly administered physiological saline, and the two experimental groups were intramuscularly injected with low-dose (2 μg/dose) or high-dose (8 μg/dose) BBIBP-CorV. (Wang et al., 2020)
Immune Response: Before virus challenge at D24, the geometric mean titer of neutralizing antibodies in the low-dose and high-dose groups reached 215 and 256, respectively. (Wang et al., 2020)
Challenge Protocol: At D24 (10 days after the second immunization), all macaques were intratracheally challenged with l06 TCID50 of SARS-CoV-2 per monkey under anesthesia. (Wang et al., 2020)
Efficacy: All placebo macaques showed and maintained a high viral load during the whole evaluation period after virus challenge by both throat and anal swabs. In contrast, the viral load in the throat swabs of the low-dose group peaked (5.33 log10copies/mL) at 5 dpi and then decreased to 1.12 log10copies/mL at 7 dpi, which was significantly lower than that of the placebo group. Moreover, no viral load was detected in the anal swabs of two (out of four) macaques in the high-dose group. (Wang et al., 2020) No macaques in the low-dose and high-dose groups had a detectable viral load in any lung lobe, which was significantly different from the results in the placebo group. Furthermore, all macaques that received vaccination showed normal lung with focal mild histopathological changes in few lobes, demonstrating the BBIBP-CorV vaccination could efficiently block the infection of SARS-CoV-2 and COVID-19 disease in monkey. At 7 dpi, the macaques treated with placebo produced low-level NAb with a titer of 1:16, whereas the NAb levels of the vaccinated macaques were highest at 1:2,048 (average 1:860) in the high-dose group and 1:1,024 in the low-dose group (average 1:512). Taken together, all these results demonstrated that both low-dose and high-dose BBIBP-CorV conferred highly efficient protection against SARS-CoV-2 in macaques without observed antibody-dependent enhancement of infection. (Wang et al., 2020)

25. BBV154

a. Manufacturer:

Bharat Biotech

b. Vaccine Ontology ID:

VO_0005227

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Nasal spray

g. Human Response

Vaccination Protocol: induces high levels of neutralizing antibodies, promotes systemic and mucosal immunoglobulin A (IgA) and T cell responses, and almost entirely prevents SARS-CoV-2 infection in both the upper and lower respiratory tracts. PubMed ID: 32931734 (Hassan et. al 2020)
Immune Response: This study showed that the vaccine induced in humans high levels of neutralizing antibodies, promotes systemic and mucosal immunoglobulin A (IgA) and T cell responses, and almost entirely prevents SARS-CoV-2 infection in both the upper and lower respiratory tracts (PubMed ID: 32931734) (Hassan et. al 2020).

h. Human Response

Description: A clinical trial on this vaccine, titled "Safety and Immunogenicity of an Intranasal SARS-CoV-2 Vaccine (BBV154) for COVID-19", is reported: NCT04751682 (https://clinicaltrials.gov/ct2/show/NCT04751682) (NCT04751682).

26. Betuvax-CoV2

a. Manufacturer:

Human Stem Cell Institute

b. Vaccine Ontology ID:

VO_0005406

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

27. ChAd-triCoV/Mac

a. Manufacturer:

McMaster University

b. Vaccine Ontology ID:

VO_0005342

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

S1 region of SARS-CoV-2 spike protein (aa 47-716) and full-length SARS-CoV-2 nucleoprotein (N) fused to a highly conserved portion of the SARS-CoV-2 polymerase (RdRp or POL)

g. Vector:

E1 and E3 deleted replication deficient chimpanzee adenovirus serotype 68

h. Immunization Route

intranasal immunization

28. ChAdV68-S

a. Manufacturer:

Gritstone Oncology

b. Vaccine Ontology ID:

VO_0005228

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

29. Chinese Academy of Medical Sciences COVID-19 vaccine

a. Tradename:

Covidful

b. Vaccine Ontology ID:

VO_0005166

c. Type:

Live, attenuated vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Baboon

f. Immunization Route

Intramuscular injection (i.m.)

30. ChulaCov19

a. Manufacturer:

Chulalongkorn University

b. Vaccine Ontology ID:

VO_0005175

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

31. CIGB-669

a. Manufacturer:

Center for Genetic Engineering and Biotechnology

b. Vaccine Ontology ID:

VO_0005083

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

intranasal immunization

32. COH04S1

a. Manufacturer:

City of Hope Medical Center

b. Vaccine Ontology ID:

VO_0005176

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

33. Comirnaty

a. Product Name:

BNT162b2

b. Manufacturer:

Pfizer, BioNTech

c. Vaccine Ontology ID:

VO_0004987

d. CDC CVX code:

208

e. CDC CVX description:

SARS-COV-2 (COVID-19) vaccine, mRNA, spike protein, LNP, preservative free, 30 mcg/0.3mL dose

f. Type:

mRNA vaccine

g. Status:

Licensed

h. Host Species for Licensed Use:

Human

i. Antigen

trimerized SARS-CoV-2 receptor-binding domain from S

j. Vector:

Lipid nanoparticle

k. Immunization Route

Intramuscular injection (i.m.)

l. Storage

-70°C ±10°C

m. Description

A SARS-CoV-2 RNA vaccine formed from a lipid nanoparticle-formulated trimerized SARS-CoV-2 receptor-binding domain

n. Macaque Response

Vaccination Protocol: Groups of six male, 2-4 year old rhesus macaques were immunized IM with 30 or 100 μg of BNT162b2 or saline control on Days 0 and 21. (Vogel et al., 2020)
Immune Response: Seven days after Dose 2 (Day 28), the GMCs of S1-binding IgG were 30,339 units (U)/mL (30 μg dose level) and 34,668 U/mL (100 μg dose level). Fifty percent virus neutralisation GMTs, measured by an authentic SARS-CoV-2 neutralisation assay25, were detectable in rhesus macaque sera by Day 21 after Dose 1 and peaked at a GMT of 962 (Day 35, 14 days after Dose 2 of 30 μg) or 1,689 (Day 28, 7 days after Dose 2 of 100 μg; Fig. 3b). Robust GMTs of 285 for 30 μg and 310 for 100 μg dose levels persisted to at least Day 56. Strong IFNγ but minimal IL-4 responses were detected by ELISpot after Dose 2. BNT162b2 elicited strong S-specific IFNγ producing T-cell responses, including a high frequency of CD4+ T cells that produced IFNγ, IL-2, and TNF but a low frequency of CD4+ T cells that produced IL-4, indicating a TH1-biased response. BNT162b2 also elicited S-specific IFNγ+ producing CD8+ T cells. (Vogel et al., 2020)
Challenge Protocol: Six rhesus macaques that had received two immunisations with 100 μg BNT162b2 and three age-matched macaques that had received saline were challenged 55 days after Dose 2 with 1.05 × 106 plaque forming units of SARS-CoV-2 (strain USA-WA1/2020), split equally between intranasal and intratracheal routes. Three additional non-immunised, age-matched rhesus macaques (sentinels) were mock-challenged with cell culture medium. (Vogel et al., 2020)
Efficacy: BNT162b2 immunization prevented lung infection in 100% of the SARS-CoV-2 challenged rhesus macaques, with no viral RNA detected in the lower respiratory tract of immunized and challenged animals. The BNT162b2 vaccination also cleared the nose of detectable viral RNA in 100% of the SARS-CoV-2 challenged rhesus macaques within 3 days after the infection. (Vogel et al., 2020)

o. Human Response

Vaccination Protocol: Participants 19-55 years of age were vaccinated with BNT162b2 in Germany. Twelve participants per dose cohort were assigned to receive a priming dose of 1, 10, 20 or 30 μg on day 1 and a booster dose on day 22. (Sahin et al., 2020)
Immune Response: BNT162b2 elicited strong antibody responses, with S-binding IgG concentrations above those in a COVID-19 human convalescent sample (HCS) panel. Day 29 (7 days post-boost) SARS-CoV-2 serum 50% neutralising geometric mean titers were 0.3-fold (1 µg) to 3.3-fold (30 µg) those of the HCS panel. The BNT162b2-elicited sera neutralized pseudoviruses with diverse SARS-CoV-2 S variants. In most participants, S-specific CD8+ and T helper type 1 (TH1) CD4+ T cells had expanded, with a high fraction producing interferon-γ (IFNγ). CD8+ T cells were shown to be of the early-differentiated effector-memory phenotype, with single specificities reaching 0.01-3% of circulating CD8+ T cells. Vaccination with BNT162b2 at well tolerated doses elicits a combined adaptive humoral and cellular immune response, which together may contribute to protection against COVID-19. (Sahin et al., 2020)
Side Effects: No serious adverse events (SAE) and no withdrawals due to related adverse events (AEs) were observed at any dose level. Local reactions, predominantly pain at the injection site, were mild to moderate (grade 1 and 2) and were similar in frequency and severity after the priming and booster doses. The most common systemic AEs were fatigue followed by headache and only two participants reported fever, which was mild. Transient chills were more common after the boost, dose-dependent, and occasionally severe. Muscle pain and joint pain were also more common after the boost and showed dose-dependent severity. There were no grade 4 reactions. Generally, reactions had their onset within 24 hours of immunisation, peaked on the day after immunisation, and mostly resolved within 2-3 days. Reactions did not require treatment or could be managed with simple measures (e.g. paracetamol). (Sahin et al., 2020)

34. Corbevax

a. Manufacturer:

Biological E

b. Vaccine Ontology ID:

VO_0005081

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

35. CoronaVac

a. Product Name:

PiCoVacc

b. Manufacturer:

Sinovac Biotech Ltd

c. Vaccine Ontology ID:

VO_0005142

d. Type:

Inactivated or "killed" vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Host Species as Laboratory Animal Model:

Mouse, Macaque, Rat

h. Antigen

Whole virus (Gao et al., 2020)

i. Preparation

The virus was propagated in a 50-liter culture of Vero cells using the Cell Factory system and inactivated by using β-propiolactone The virus was purified using depth filtration and two optimized steps of chromatography, yielding a highly pure preparation of PiCoVacc. (Gao et al., 2020)

j. Immunization Route

Intramuscular injection (i.m.)

k. Description

A purified inactivated SARS-CoV-2 virus vaccine(Gao et al., 2020)

l. Mouse Response

Host Strain: BALB/c mouse
Vaccination Protocol: Mice were vaccinated at day 0 and 7 with either 1.5 μg/dose, 3.0 μg/dose, or 6.0 μg/dose on both days. (Gao et al., 2020)
Immune Response: SARS-CoV-2 S- and RBD-specific immunoglobulin G (Ig G) developed quickly in the serum of vaccinated mice and peaked at the titer of 819,200 (>200 μg/ml) and 409,600 (>100 μg/ml), respectively, at week 6(Gao et al., 2020)
Description: BALB/c mice were injected with vaccine 5761 at days 0 and 7.(Gao et al., 2020)

m. Rat Response

Host Strain: Wistar
Vaccination Protocol: Rats were vaccinated at day 0 and 7 with either 1.5 μg/dose, 3.0 μg/dose, or 6.0 μg/dose on both days.(Gao et al., 2020)
Immune Response: Immune Response Description: SARS-CoV-2 S- and RBD-specific immunoglobulin G (Ig G) developed quickly in the serum of vaccinated rats and the maximum neutralizing titers reached 2,048-4,096 at week 7 (Gao et al., 2020)

n. Macaque Response

Host Strain: Rhesus macaque
Vaccination Protocol: Macaques were immunized three times via the intramuscular route with medium (3 μg per dose) or high doses (6 μg per dose) of PiCoVacc at day 0, 7 and 14 (n=4)(Gao et al., 2020)
Immune Response: . S-specific IgG and NAb were induced at week 2 and rose to ~12,800 and ~50, respectively at week 3 after vaccination in both vaccinated groups, whose titers are similar to those of serum from the recovered COVID-19 patients. NAb titer (61) in the medium dose immunized group were ~20% greater than that observed (50) in the high dose vaccinated group at week 3, removing the outlier instead have medium dose group be ~40% lower than that in the high dose group (Gao et al., 2020)
Side Effects: No serious pathology recorded at day 29 in vaccinated groups (Gao et al., 2020)
Challenge Protocol: Challenge protocol involved direct inoculation of 1e6 TCID50 of SARS-CoV-2 CN1 into the animal lung through the intratracheal route at day 22 (one week after the third immunization and after immune response results were recorded) (Gao et al., 2020).
Efficacy: argely protected against SARS-CoV-2 infection with very mild and focal histopathological changes in a few lobes of lung, which probably were caused by a direct inoculation of 106 TCID50 of virus into the lung through intratracheal route, that needed longer time (more than one week) to recover completely (Gao et al., 2020).

36. CORVax12

a. Manufacturer:

Providence Health & Services, OncoSec Medical Inc.

b. Type:

DNA vaccine

c. Status:

Clinical trial

d. Host Species for Licensed Use:

Human

e. Immunization Route

Intradermal injection (i.d.)

37. CoV2 SAM

a. Manufacturer:

GlaxoSmithKline

b. Vaccine Ontology ID:

VO_0005156

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

38. CoV2-OGEN1

a. Manufacturer:

US Specialty Formulations, VaxForm

b. Vaccine Ontology ID:

VO_0005263

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Oral

39. COVAC

a. Manufacturer:

Vaccine and Infectious Disease Organization, Seppic, Vaccine Formulation Institute (VFI)

b. Vaccine Ontology ID:

VO_0005194

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

40. COVAX-19

a. Product Name:

SpikoGen

b. Manufacturer:

Vaxine, CinnaGen

c. Vaccine Ontology ID:

VO_0005193

d. Type:

Subunit vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

41. COVAXIN

a. Product Name:

BBV152

b. Manufacturer:

Bharat Biotech

c. Vaccine Ontology ID:

VO_0004991

d. Type:

Inactivated or "killed" vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Adjuvant:

VO ID: VO_0005301

h. Preparation

COVAXIN is made up of an inactivated SARS-CoV-2 virus that activates the immune system to create antibodies againt the virus. When preparing the vaccine, Beta-propiolactone, an organic compound, inactivates the virus by binding to its genes. The vaccine itself contains the RNA of the virus surrounded by a protein shell that cannot be replicated. It also contains an adjuvant, Alhydroxiquim-II, which includes a molecule attached to Alhydrogel (alum used in many adjuvants). After injection of the vaccine, the adjuvant moves to the lymph nodes, where it separates from the alum and attaches to two cell receptors, activating a TLR7/8 agonist and Th1 immune system response. The virus contains a receptor on its outer-shell which is adsobrded to the adjuvant. (Ella et al., 2021; LABline, 2021; Thiagarajan, 2021)

i. Immunization Route

Intramuscular injection (i.m.)

j. Macaque Response

Vaccination Protocol: Twenty adult rhesus macaques aged 3 - 12 years were divided into 4 groups of five animals (3 M, 2 F) each viz. the placebo (group I), group II, III, and IV. The placebo group was administered Phosphate buffer saline (PBS), group II, III, and IV were immunized with formulations of purified inactivated SARS-CoV-2 vaccine candidate 6μg+Adjuvant-A(BBV152C), 3μg+Adjuvant-B (BBV152A), and 6μg+Adjuvant-B (BBV152B) respectively. Animals were administered with two doses of vaccine/placebo on days 0 and 14 respectively intramuscularly in the deltoid region. Blood samples were collected on 0, 12, 19, 26, and 28 days for assessing the anti-SARS IgG antibody and NAb titers.
Immune Response: We evaluated anti-SARS-CoV-2 Immunoglobulin-G (IgG) antibody and neutralizing antibody (NAb) titers from the serum samples during the immunization phase (0, 12, 19, 26 and 28 days) and after SARS-CoV-2 infection (0, 1, 3, and 7). IgG levels were detectable from 3rd-week post-immunization and were found increasing till 35th day [7 days post-infection (DPI)]. Group III showed the highest IgG titer (1:25600) compared to group II and IV (1:1600-1:6400). The highest NAb titers of 1:209 to 1:5,217 were detected in group III after the SARS-CoV-2 challenge. The NAb titers for groups II and IV were (1:87.4 - 1: 3974) and (1:29.5 -1: 3403) respectively. These NAb titers correlated with the IgG antibody titers. NAb and IgG response was not detectable in the placebo group.
Side Effects: Adverse events were not seen in animals immunized with a two-dose vaccination regimen.
Challenge Protocol: After completion of twenty eight-days of immunization, animals were challenged with 1 ml of SARS-CoV-2 (P-3, NIV-2020770, TCID50 106.5/ml)19 intratracheally and 0.25 ml in each nostril. NS, TS, rectal swab, chest X-ray, blood specimens, and BAL fluid were collected on 0, 1, 3, 5, and 7 DPI.
Efficacy: Vaccinated groups had a detectable level of gRNA from 1 to 5 DPI with viral clearance on 7 DPI (Figure 2B). sgRNA was not detected in TS specimens of animals from either group. In the vaccinated groups, gRNA was detected in BAL specimens until 3 DPI (Figure 2C). sgRNA was detected in BAL specimens of four out of five animals of the placebo group, while it was not detected in BAL specimens of vaccinated groups. Except for the placebo group, none of the vaccinated groups showed the presence of gRNA in lung lobes (Figure 2D). The comparisons of viral copy numbers of the NS, TS, and the BAL fluid samples of the vaccinated as compared to the placebo group were found to be statistically significant using the two-tailed Mann-Whitney test.

k. Human Response

Vaccination Protocol: A double-blind, multicentre, randomised, controlled phase 1 trial was conducted to assess the safety and immunogenicity of BBV152 at 11 hospitals across India. Healthy adults aged 18–55 years who were deemed healthy by the investigator were eligible. The vaccine candidates were formulated with two adjuvants: Algel (alum) and Algel-IMDG, an imidazoquinoline class molecule (TLR7 and TLR8 agonist) adsorbed onto Algel. Participants were randomly assigned to receive either one of three vaccine formulations (3 μg with Algel-IMDG, 6 μg with Algel-IMDG, or 6 μg with Algel) or an Algel only control vaccine group. The vaccine (BBV152) and the control were provided as a sterile liquid that was injected intramuscularly (deltoid muscle) at a volume of 0·5 mL/dose in a two-dose regimen on day 0 (day of randomisation) and day 14. [Ella et al., 2021]
Immune Response: IgG titres (GMTs) to all epitopes (spike protein, receptor-binding domain, and nucleocapsid protein) increased rapidly after the administration of both doses. Both 3 μg and 6 μg with Algel-IMDG groups reported similar anti-spike, anti-receptor binding, and anti-nucleoprotein IgG titres (GMTs), adding to the dose-sparing effect of the adjuvant. The mean isotyping ratios (IgG1/IgG4) were greater than 1 for all vaccinated groups, which was indicative of a Th1 bias. Seroconversion rates (after the second dose), based on MNT50 were 87·9% (95% CI 79·8–94·3) in the 3 μg with Algel-IMDG group, 91·9% (84·6–96·0) in the 6 μg with Algel-IMDG group, and 82·8% (73·7–89·2) in the 6 μg with Algel group. Seroconversion (at day 28) in the control group was reported in six (8% [3·6–17·2]) of 75 participants, suggestive of asymptomatic infection. The vaccine-induced responses were similar to those observed in the convalescent serum collected from 41 patients who had recovered from COVID-19 (figure 3B). On these 41 patients, the median titre of symptomatic patients (n=25; median 142·2 [IQR 56·6–350]) was significantly higher than that of the asymptomatic patients (n=16; 22·6 [9·0–56·5]).Randomly selected serum samples from day 28 were analysed by PRNT50 at the National Institute of Virology with homologous and heterologous strain assessments. Neutralisation responses, regardless of the challenge strain, were observed. In a subset of randomly selected blood samples at one site, IFN-γ ELISpot responses against SARS-CoV-2 peptides peaked at about 100–120 spot-forming cells per million peripheral blood mononuclear cells in all vaccinated groups on day 28. Both the Algel-IMDG groups elicited CD3+, CD4+, and CD8+ T-cell responses that were reflected in the IFN-γ production, albeit in a small number of samples. However, there was a minimal detection of less than 0·5% of CD3+, CD4+, and CD8+ T-cell responses in the 6 μg with Algel group and the Algel only group. [Ella et al., 2021]
Efficacy: Because this is an interim report, we are not reporting any data on the persistence of vaccine-induced antibody responses or long-term safety outcomes. The results reported here do not permit efficacy assessments. The analysis of safety outcomes requires more extensive phase 2 and 3 clinical trials. [Ella et al., 2021]

42. CoVepiT

a. Manufacturer:

OSE Immunotherapeutics

b. Vaccine Ontology ID:

VO_0005261

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

43. Covi Vax

a. Product Name:

NRC-VACC-101

b. Manufacturer:

National Research Centre, Egypt

c. Vaccine Ontology ID:

VO_0005349

d. Type:

Inactivated or "killed" vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Antigen

A human coronavirus (hCoV)-19/Egypt/NRC-03/2020 SARS-CoV-2 strain

h. Immunization Route

Intramuscular injection (i.m.)

44. COVI-VAC

a. Manufacturer:

Codagenix, Inc.

b. Vaccine Ontology ID:

VO_0005187

c. Type:

Live, attenuated vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

intranasal immunization

45. COVID-19 aAPC vaccine

a. Manufacturer:

Shenzhen Geno-Immune Medical Institute

b. Vaccine Ontology ID:

VO_0005184

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

46. COVID-19 DNA vaccine by the University of Hong Kong and Immuno Cure 3 Limited

a. Manufacturer:

University of Hong Kong and Immuno Cure 3 Limited

b. Vaccine Ontology ID:

VO_0005346

c. Type:

DNA vaccine

d. Status:

Licensed

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

47. COVID-19 inactivated vaccine by the Scientific and Technological Research Council of Turkey

a. Manufacturer:

Scientific and Technological Research Council of Turkey (TÜBITAK)

b. Vaccine Ontology ID:

VO_0005257

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

g. Description

Adjuvanted inactivated vaccine against SARS-CoV-2

48. COVID-19 mRNA vaccine by CanSino Biologics

a. Manufacturer:

CanSino Biologics Inc.

b. Vaccine Ontology ID:

VO_0005407

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

49. COVID-19 mRNA vaccine by Shanghai East Hospital and Stemirna Therapeutics

a. Manufacturer:

Shanghai East Hospital and Stemirna Therapeutics

b. Vaccine Ontology ID:

VO_0005260

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

50. COVID-19 rNDV vector vaccine by Laboratorio Avi-Mex

a. Manufacturer:

Laboratorio Avi-Mex

b. Vaccine Ontology ID:

VO_0005259

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

51. COVID-19 subunit vaccine by HIPRA

a. Manufacturer:

Laboratorios Hipra, S.A.

b. Vaccine Ontology ID:

VO_0005321

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

52. COVID-19 subunit vaccine by National Vaccine and Serum Institute of China

a. Manufacturer:

National Vaccine and Serum Institute of China

b. Vaccine Ontology ID:

VO_0005248

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

53. COVID-19 subunit vaccine by PT Bio Farma

a. Manufacturer:

PT Bio Farma

b. Vaccine Ontology ID:

VO_0005343

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

54. COVID-eVax

a. Manufacturer:

Takis, Rottapharm Biotech

b. Vaccine Ontology ID:

VO_0005230

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

55. COVIDITY

a. Manufacturer:

Scancell Ltd.

b. Vaccine Ontology ID:

VO_0005344

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Vaccination Protocol: Needle free injection
Description: A clinical trial on this vaccine is conducted, with the clinical trial ID - NCT05047445: (NCT05047445 - COVIDITY)

56. Covifenz

a. Product Name:

CoVLP

b. Manufacturer:

Medicago Inc.

c. Vaccine Ontology ID:

VO_0004992

d. Type:

Virus Like Particle

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

57. COVIGEN

a. Manufacturer:

University of Sydney, Bionet Co., Ltd, Technovalia

b. Vaccine Ontology ID:

VO_0005231

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

58. Covigenix VAX-001

a. Manufacturer:

Entos Pharmaceuticals

b. Vaccine Ontology ID:

VO_0005186

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

59. COVIran Barakat

a. Manufacturer:

Shifa Pharmed Industrial Co

b. Vaccine Ontology ID:

VO_0005229

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

60. CoviVac (Russia)

a. Manufacturer:

Chumakov Centre at the Russian Academy of Sciences

b. Vaccine Ontology ID:

VO_0005243

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

61. COVIVAC (Vietnam)

a. Manufacturer:

Institute of Vaccines and Medical Biologicals, Vietnam

b. Vaccine Ontology ID:

VO_0005246

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

62. CV2CoV

a. Vaccine Ontology ID:

VO_0005168

b. Type:

RNA vaccine

c. Status:

Clinical trial

d. Host Species for Licensed Use:

Human

e. Immunization Route

Intramuscular injection (i.m.)

f. Description

A SARS-CoV-2 mRNA vaccine developed by CureVac AG and CEPI (NCT04449276)

63. CVXGA1

a. Manufacturer:

CyanVac LLC

b. Vaccine Ontology ID:

VO_0005318

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

intranasal immunization

64. DelNS1-2019-nCoV-RBD-OPT1

a. Manufacturer:

University of Hong Kong, Xiamen University, Beijing Wantai Biological Pharmacy

b. Vaccine Ontology ID:

VO_0005087

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

intranasal immunization

65. DoCo-Pro-RBD-1 + MF59

a. Manufacturer:

University of Melbourne

b. Vaccine Ontology ID:

VO_0005395

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

66. DS-5670a

a. Manufacturer:

Daiichi Sankyo Co., Ltd.

b. Vaccine Ontology ID:

VO_0005245

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

67. EG-COVID

a. Manufacturer:

EyeGene Inc.

b. Vaccine Ontology ID:

VO_0005408

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

68. EgyVax

a. Manufacturer:

Eva Pharma

b. Vaccine Ontology ID:

VO_0005396

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

69. EpiVacCorona

a. Manufacturer:

FBRI State Research Center of Virology and Biotechnology

b. Vaccine Ontology ID:

VO_0005088

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

70. EuCorVac-19

a. Manufacturer:

EuBiologics Co., Ltd.

b. Vaccine Ontology ID:

VO_0005232

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

71. EXG-5003

a. Manufacturer:

Elixirgen Therapeutics, Inc.

b. Vaccine Ontology ID:

VO_0005249

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intradermal injection (i.d.)

72. GEMCOVAC-19

a. Manufacturer:

Gennova Biopharmaceuticals Limited

b. Vaccine Ontology ID:

VO_0005413

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

73. GLS-5310

a. Manufacturer:

GeneOne Life Science, Inc.

b. Vaccine Ontology ID:

VO_0005089

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intradermal injection (i.d.)

74. GRAd-CoV2

a. Manufacturer:

ReiThera

b. Vaccine Ontology ID:

VO_0005169

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

SARS-CoV-2 S protein (NCT04528641)

g. Vector:

Gorilla adenovirus (NCT04528641)

h. Immunization Route

Intramuscular injection (i.m.)

i. Description

A SARS-CoV 2 recombinant viral vector using Gorilla Adenovirus that encodes for SARS-CoV-2 Spike protein.
(NCT04528641)

75. GRT-R912

a. Manufacturer:

Gritstone Bio, Inc.

b. Vaccine Ontology ID:

VO_0005397

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

76. GX-19

a. Manufacturer:

Genexine

b. Vaccine Ontology ID:

VO_0005170

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

S protein (NCT04445389)

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

A SARS-CoV-2 DNA vaccine expressing the SARS-CoV-2 S protein (NCT04445389)

77. hAd5-COVID-19

a. Manufacturer:

ImmunityBio, Inc.; NantKwest Inc.

b. Vaccine Ontology ID:

VO_0005189

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

78. HDT-301

a. Product Name:

repRNA-CoV2S

b. Manufacturer:

SENAI CIMATEC

c. Vaccine Ontology ID:

VO_0005256

d. Type:

mRNA vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Host Species as Laboratory Animal Model:

Mouse

h. Antigen

full-length spike (S) protein

i. Immunization Route

Intramuscular injection (i.m.)

j. Description

Alphavirus-derived replicon RNA vaccine candidate, repRNA-CoV2S, encoding the SARS-CoV-2 spike (S) protein. The RNA replicons were formulated with lipid inorganic nanoparticles (LIONs) that were designed to enhance vaccine stability, delivery, and immunogenicity. (Erasmus et al., 2020)

79. IIBR-100

a. Manufacturer:

Israel Institute for Biological Research, Weizmann Institute of Science

b. Vaccine Ontology ID:

VO_0005090

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

80. IMP CoVac-1

a. Manufacturer:

University Hospital Tuebingen

b. Vaccine Ontology ID:

VO_0005190

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

81. IN-B009

a. Manufacturer:

HK inno.N Corporation

b. Vaccine Ontology ID:

VO_0005351

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

82. INO-4800

a. Manufacturer:

Inovio Pharmaceuticals

b. Vaccine Ontology ID:

VO_0005172

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Host Species as Laboratory Animal Model:

mice, guinea pigs

g. Antigen

S protein (Smith et al., 2020)

h. Vector:

pGX9501 plasmid (Smith et al., 2020)

i. Immunization Route

Intradermal injection (i.d.)

j. Description

A DNA vaccine that expresses S protein from the pGX9501 vector(Smith et al., 2020)

k. Human Response

Vaccination Protocol: INO-4800 was evaluated in two groups of 20 participants, receiving either 1.0 mg or 2.0 mg of vaccine intradermally followed by CELLECTRA® EP at 0 and 4 weeks. Thirty-nine subjects completed both doses; one subject in the 2.0 mg group discontinued trial participation prior to receiving the second dose. ClinicalTrials.gov identifier: NCT04336410. (Tebas et al., 2020)
Immune Response: By week 6, 95% (36/38) of the participants seroconverted based on their responses by generating binding (ELISA) and/or neutralizing antibodies (PRNT IC50), with responder geometric mean binding antibody titers of 655.5 [95% CI (255.6, 1681.0)] and 994.2 [95% CI (395.3, 2500.3)] in the 1.0 mg and 2.0 mg groups, respectively. For neutralizing antibody, 78% (14/18) and 84% (16/19) generated a response with corresponding geometric mean titers of 102.3 [95% CI (37.4, 280.3)] and 63.5 [95% CI (39.6, 101.8)], in the respective groups. By week 8, 74% (14/19) and 100% (19/19) of subjects generated T cell responses by IFN-ɣ ELISpot assay with the median SFU per 106 PBMC of 46 [95% CI (21.1, 142.2)] and 71 [95% CI (32.2, 194.4)] in the 1.0 mg and 2.0 mg groups, respectively. Flow cytometry demonstrated a T cell response, dominated by CD8+ T cells co-producing IFN-ɣ and TNF-α, without increase in IL-4. (Tebas et al., 2020)
Side Effects: Through week 8, only 6 related Grade 1 adverse events in 5 subjects were observed. None of these increased in frequency with the second administration. No serious adverse events were reported. (Tebas et al., 2020)

l. Mouse Response

Vaccination Protocol: BALB/c mice were immunized twice with 10 micrograms of INO-4800, on days 0 and 14, and sera was collected on day 7 post-second immunization. (Smith et al., 2020)
Immune Response: Neutralization ID50 average titers of 92.2 were observed in INO-4800 immunized mice. No reduction in RLU (relative luciferase units) was observed for the control animals. Sera from INO-4800 immunized BALB/c mice neutralized both SARS-CoV-2/WH-09/human/2020 and SARS-CoV-2/Australia/VIC01/2020 virus strains with average ND50 titers of 97.5 and 128.1, respectively. Sera from INO-4800 immunized C57BL/6 mice neutralized wildtype SARS-CoV-2 virus with average ND50 titer of 340. Inhibition of the Spike-ACE2 interaction was compared using serum IgG from a naïve mouse and from an INO-4800 vaccinated mouse. The receptor inhibition assay was repeated with a group of five immunized mice, and demonstrating that INO-4800-induced antibodies competed with ACE2 binding to the SARS-CoV-2 Spike protein. (Smith et al., 2020) Flow cytometric analysis on splenocytes harvested from BALB/c mice on Day 14 after a single INO-4800 immunization revealed the T cell compartment to contain 0.04% CD4+ and 0.32% CD8+ IFN-γ+ T cells after stimulation with SARS-CoV-2 antigens. (Smith et al., 2020) CoV vaccine-induced immunopathology utilized the BALB/c mouse, a model known to preferentially develop Th2-type responses. The DNA vaccine platform induces Th1-type immune responses and has demonstrated efficacy without immunopathology in models of respiratory infection. (Smith et al., 2020)

83. Johnson & Johnson COVID-19 vaccine

a. Product Name:

Ad26.COV2.S

b. Tradename:

JNJ-78436735

c. Manufacturer:

Janssen Pharmaceutica

d. Vaccine Ontology ID:

VO_0005159

e. CDC CVX code:

212

f. CDC CVX description:

SARS-COV-2 (COVID-19) vaccine, vector non-replicating, recombinant spike protein-Ad26, preservative free, 0.5 mL

g. Type:

Recombinant vector vaccine

h. Status:

Clinical trial

i. Host Species for Licensed Use:

Human

j. Host Species as Laboratory Animal Model:

macaques

k. Antigen

S protein with tissue plasminogen activator leader sequence and two proline stabilizing mutations (Mercado et al., 2020)

l. Gene Engineering of spike (S) protein

Type: Recombinant vector construction
Description: The S protein gene is engineered to be added to the Ad viral vaccine vector for expression (Mercado et al., 2020).
Detailed Gene Information: Click here.

m. Vector:

adenovirus serotype 26 (Ad26) (Mercado et al., 2020)

n. Immunization Route

intranasal immunization

o. Description

A recombinant viral vector virus using adenovirus serotype26 vector experssing the S protein (Mercado et al., 2020).
Ad26.COV2.S is currently undergoing a Phase III clinical trial: (NCT04505722)

p. Macaque Response

Vaccination Protocol: Immunized vector with Ad26 vaccine with immunization of 10^11 viral particles by the intramuscular route on week 0.
Immune Response: Liver titer neutralizing antibodies present (median 113; range 53-233) (Mercado et al., 2020). Presence of INF-gamma response but minimal to no IL-4 response (Mercado et al., 2020). NAb titers as measured by both assays were observed in the majority of vaccinated animals at week 2 and generally increased by week 4. The Ad26-S.PP vaccine elicited the highest pseudovirus NAb titers (median 408; range 208–643) and live virus NAb titers (median 113; range 53–233) at week 4. The Ad26-S.PP vaccine also induced detectable S-specific IgG and IgA responses in bronchoalveolar lavage (BAL). Cellular immune responses were induced in 30 of 32 vaccinated animals at week 4. A single immunization of 1011 vp Ad26-S.PP elicited consistent IFN-γ ELISPOT responses but minimal to no IL-4 ELISPOT responses, suggesting induction of Th1-biased responses. (Mercado et al., 2020)
Challenge Protocol: Week 6 after initial vaccination had each animal exposed to 1^4 TCID50 SARS-CoV2 vy the intranasal and intratracheal routes (Mercado et al., 2020).
Efficacy: Complete protection called due to no detecable vius in bronchoalveolar lavage with limit of detectin of 1.69log10sgRNAcopies/Ml (Mercado et al., 2020). Macaques that were treated with Ad26-S.PP had no detectable virus in BAL samples. Only one of the macaques that received the Ad26-S.PP vaccine showed a low amount of virus in nasal swabs. All vaccinated macaques showed no detectable infectious virus in nasal swabs by plaque-forming unit (PFU) assays. A comparison of peak viral loads in the vaccinated macaques suggested that protection in BAL samples was generally more robust than in nasal swabs (Fig. 5). The Ad26-S.PP vaccine provided complete protection in both the lower and upper respiratory tract with the exception of one macaque that showed a low amount of virus in nasal swabs, and resulted in greater than 3.2 and 3.9 log10-transformed reductions of median peak sgRNA in BAL and nasal swabs, respectively, as compared with sham controls (P < 0.0001 and P < 0.0001, respectively, two-sided Mann–Whitney tests) (Fig. 5). Among the 32 vaccinated macaques, 17 were completely protected and had no detectable sgRNA in BAL or nasal swabs after challenge, and 5 additional macaques had no sgRNA in BAL but showed some virus in nasal swabs. (Mercado et al., 2020)

84. KBP-COVID-19

a. Vaccine Ontology ID:

VO_0005171

b. Type:

Subunit vaccine

c. Status:

Clinical trial

d. Host Species for Licensed Use:

Human

e. Antigen

RBD domain of S protein (Saha et al., 2020)

f. Immunization Route

Intramuscular injection (i.m.)

g. Description

A SARS-CoV-2 subunit vaccine with a protein subunit.(Saha et al., 2020)

85. KCONVAC

a. Manufacturer:

Shenzhen Kangtai Biological Products Co., Ltd.; Beijing Minhai Biotechnology Co.

b. Vaccine Ontology ID:

VO_0005084

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

86. KD-414

a. Manufacturer:

KM Biologics Co., Ltd.

b. Vaccine Ontology ID:

VO_0005250

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

87. Koçak-19 Inaktif Adjuvanlı COVID-19 Vaccine

a. Manufacturer:

Kocak Farma

b. Vaccine Ontology ID:

VO_0005253

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

whole virus

g. Immunization Route

Intramuscular injection (i.m.)

88. LNP-nCOV saRNA-02

a. Manufacturer:

MRC/UVRI and LSHTM Uganda Research Unit

b. Vaccine Ontology ID:

VO_0005276

c. Type:

RNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

89. LNP-nCoVsaRNA

a. Product Name:

COVAC1

b. Manufacturer:

Imperial College London

c. Vaccine Ontology ID:

VO_0005143

d. Type:

RNA Vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Antigen

spike (S) protein (McKay et al., 2020)

h. Vector:

Lipid nanoparticle (LNP)(McKay et al., 2020)

i. Immunization Route

Intramuscular injection (i.m.)

j. Description

A SARS-CoV-2 vaccine made of self-coding RNA encoding SARS-CoV-2 spike protein encapsulated within a lipid nanoparticle (McKay et al., 2020).

90. LV-SMENP-DC

a. Manufacturer:

Shenzhen Geno-Immune Medical Institute

b. Vaccine Ontology ID:

VO_0005091

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

91. LVRNA009

a. Manufacturer:

AIM Vaccine Co., Ltd.

b. Vaccine Ontology ID:

VO_0005414

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Description

Phase I: NCT05364047
Phase II: NCT05352867

h. Mouse Response

Immune Response: serum samples from mice immunized with monovalent Delta vaccine showed relatively low virus neutralization titers (VNTs) against the pseudotyped virus of the Omicron strains. Serum samples from mice immunized with bivalent Delta/BA.1 vaccine had high VNTs against the pseudotyped Wuhan-Hu-1, Delta, and BA.1 strains but low VNTs against BA.2 and BA.5 (p < 0.05). Serum samples from mice immunized with Delta/BA.2 vaccine had high VNTs against the pseudotyped Wuhan-Hu-1, Delta, BA.1 and BA.2 strains but low VNTs against BA.5. Finally, serum samples from mice immunized with Delta/BA.5 vaccine had high VNTs against all the tested pseudotyped SARS-CoV-2 strains including the Wuhan-Hu-1, Delta, and Omicron variants (p > 0.05).(Li et al., 2022)

92. LYB001

a. Manufacturer:

Yantai Patronus Biotech Co., Ltd.

b. Vaccine Ontology ID:

VO_0005348

c. Type:

Virus Like Particle

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Description

Phase I: NCT05125926 (NCT05125926)

h. Human Response

Vaccination Protocol: The study vaccine will be administered IM at upper arm deltoid as a three-dose regimen with 28d interval on day 0, 28, 56.
Description: This is a randomized, double-blind, placebo-controlled Phase Ⅰ trial in healthy adults aged 18 years and older, intended to evaluate the safety, reactogenicity, and immunogenicity profile of LYB001 (NCT05125926)

93. MF59-adjuvanted SARS-CoV-2 Sclamp vaccine

a. Manufacturer:

The University of Queensland

b. Vaccine Ontology ID:

VO_0005258

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

The SARS-CoV-2 sclamp antigen comprises a trimeric glycosylated SARS-CoV-2 spike glycoprotein ectodomain fused to a molecular clamp. (Chappell et al., 2021)

g. Immunization Route

Intramuscular injection (i.m.)

94. MIPSCo-mRNA-RBD-1

a. Manufacturer:

University of Melbourne

b. Vaccine Ontology ID:

VO_0005398

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

95. Moderna COVID-19 vaccine

a. Product Name:

mRNA-1273

b. Manufacturer:

Moderna

c. Vaccine Ontology ID:

VO_0005157

d. CDC CVX code:

207

e. CDC CVX description:

SARS-COV-2 (COVID-19) vaccine, mRNA, spike protein, LNP, preservative free, 100 mcg/0.5mL dose

f. Type:

mRNA vaccine

g. Status:

Licensed

h. Host Species for Licensed Use:

Human

i. Antigen

S-2P antigen, made of the SARS-CoV-2 glycoprotein with a transmembrane anchor and intact S1-S2 cleavage site (Wang et al., 2020).

j. Vector:

lipid nanoparticle (Wang et al., 2020)

k. Immunization Route

Intramuscular injection (i.m.)

l. Description

A SARS-CoV2 RNA vaccine made of lipid nanoparticle with mRNA which encodes the S-2P antigen, made of the SARS-CoV-2 glycoprotein with a transmembrane anchor and intact S1-S2 cleavage site (Wang et al., 2020).

m. Macaque Response

Vaccination Protocol: Animals were vaccinated intramuscularly at week 0 and at week 4 with either 10 or 100 μg of mRNA-1273 in 1 ml of 1× phosphate-buffered saline (PBS) into the right hind leg. (Corbett et al., 2020)
Immune Response: The mRNA-1273 vaccine candidate induced antibody levels exceeding those in human convalescent-phase serum, with live-virus reciprocal 50% inhibitory dilution (ID50) geometric mean titers of 501 in the 10-μg dose group and 3481 in the 100-μg dose group. Vaccination induced type 1 helper T-cell (Th1)–biased CD4 T-cell responses and low or undetectable Th2 or CD8 T-cell responses. (Corbett et al., 2020)
Challenge Protocol: At week 8 (4 weeks after the second vaccination), all animals were challenged with a total dose of 7.6×105 plaque-forming units (PFU). The stock of 1.9×105 PFU per milliliter SARS-CoV-2 (USA-WA1/2020 strain) was administered in a volume of 3 ml by the intratracheal route and in a volume of 1 ml by the intranasal route (0.5 ml per nostril). (Corbett et al., 2020)
Efficacy: Viral replication was not detectable in BAL fluid by day 2 after challenge in seven of eight animals in both vaccinated groups. No viral replication was detectable in the nose of any of the eight animals in the 100-μg dose group by day 2 after challenge, and limited inflammation or detectable viral genome or antigen was noted in lungs of animals in either vaccine group. (Corbett et al., 2020)

n. Human Response

Vaccination Protocol: All the participants were assigned sequentially to receive two doses of either 25 μg or 100 μg of vaccine administered 28 days apart. (Anderson et al., 2020) The mRNA-1273 vaccine was administered as a 0.5-ml intramuscular injection into the deltoid on days 1 and 29 of the study.
Immune Response: By day 57, among the participants who received the 25-μg dose, the anti–S-2P geometric mean titer (GMT) was 323,945 among those between the ages of 56 and 70 years and 1,128,391 among those who were 71 years of age or older; among the participants who received the 100-μg dose, the GMT in the two age subgroups was 1,183,066 and 3,638,522, respectively. After the second immunization, serum neutralizing activity was detected in all the participants by multiple methods. Binding- and neutralizing-antibody responses appeared to be similar to those previously reported among vaccine recipients between the ages of 18 and 55 years and were above the median of a panel of controls who had donated convalescent serum. The vaccine elicited a strong CD4 cytokine response involving type 1 helper T cells. (Anderson et al., 2020)
Side Effects: Solicited adverse events were predominantly mild or moderate in severity and most frequently included fatigue, chills, headache, myalgia, and pain at the injection site. Such adverse events were dose-dependent and were more common after the second immunization. (Anderson et al., 2020)

96. mRNA-1073

a. Manufacturer:

Moderna

b. Vaccine Ontology ID:

VO_0005409

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

97. mRNA-1273.211

a. Manufacturer:

Moderna

b. Vaccine Ontology ID:

VO_0005277

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Immune Response: No cases of Covid-19 with an onset of 14 days after the second injection were reported in the mRNA-1273 group, and four cases occurred in the placebo group. (Ali et al., 2021)
Side Effects: the most common solicited adverse reactions after the first or second injections were injection-site pain (in 93.1% and 92.4%, respectively), headache (in 44.6% and 70.2%, respectively), and fatigue (in 47.9% and 67.8%, respectively) (Ali et al., 2021)
Efficacy: The mRNA-1273 vaccine had an acceptable safety profile in adolescents. (Ali et al., 2021)

98. mRNA-1273.214

a. Manufacturer:

Moderna

b. Vaccine Ontology ID:

VO_0005415

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Vaccination Protocol: In this ongoing, phase 2-3 study, we compared the 50-μg bivalent vaccine mRNA-1273.214 (25 μg each of ancestral Wuhan-Hu-1 and omicron B.1.1.529 [BA.1] spike messenger RNAs) with the previously authorized 50-μg mRNA-1273 booster (Chalkias et al., 2022)
Efficacy: Vaccine effectiveness was not assessed in this study; in an exploratory analysis, SARS-CoV-2 infection occurred in 11 participants after the mRNA-1273.214 booster and in 9 participants after the mRNA-1273 booster. The bivalent omicron-containing vaccine mRNA-1273.214 elicited neutralizing antibody responses against omicron that were superior to those with mRNA-1273, without evident safety concerns. (Chalkias et al., 2022)

99. mRNA-1273.351

a. Manufacturer:

Moderna, NIAID

b. Vaccine Ontology ID:

VO_0005233

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

100. mRNA-1273.529

a. Manufacturer:

Moderna

b. Vaccine Ontology ID:

VO_0005416

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Mouse Response

Efficacy: A primary vaccination series with mRNA-1273.529, an Omicron-matched vaccine, potently neutralized BA.1 but inhibited historical or other SARS-CoV-2 variants less effectively. (Ying et al., 2022)

101. mRNA-1283

a. Manufacturer:

Moderna

b. Vaccine Ontology ID:

VO_0005185

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

102. MRT5500

a. Manufacturer:

Sanofi Pasteur, Translate Bio

b. Vaccine Ontology ID:

VO_0005241

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

103. MV-014-212

a. Manufacturer:

Meissa Vaccines, Inc.

b. Vaccine Ontology ID:

VO_0005240

c. Type:

Live, attenuated vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

Spike Protein of SARS-CoV-2

g. Immunization Route

intranasal immunization

h. Description

MV-014-212, is a live attenuated vaccine against respiratory syncytial virus (RSV) that is expressing the spike (S) protein of SARS-CoV-2. MV-014-212 is administered as drops or a spray in the nose.

104. MVA-SARS-2-S

a. Manufacturer:

Universitätsklinikum Hamburg-Eppendorf, Ludwig-Maximilians - University of Munich

b. Vaccine Ontology ID:

VO_0005191

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

105. MVA-SARS-2-ST

a. Manufacturer:

Hannover Medical School

b. Vaccine Ontology ID:

VO_0005262

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Inhaled

106. MVC-COV1901

a. Manufacturer:

Medigen, Dynavax

b. Vaccine Ontology ID:

VO_0005192

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

107. naNO-COVID

a. Manufacturer:

Emergex Vaccines Holding Ltd.

b. Vaccine Ontology ID:

VO_0005350

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intradermal injection (i.d.)

108. Nanocovax

a. Manufacturer:

Nanogen Pharmaceutical Biotechnology

b. Vaccine Ontology ID:

VO_0005092

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Hamster Response

Immune Response: A viral challenge study using the hamster model showed that Nanocovax protected the upper respiratory tract from SARS-CoV-2 infection. (Tran et. al 2021)
Side Effects: Nanocovax did not induce any adverse effects in mice (Mus musculus var. albino) and rats (Rattus norvegicus). (Tran et. al 2021)

109. NBP2001

a. Manufacturer:

SK Bioscience Co., Ltd.

b. Vaccine Ontology ID:

VO_0005234

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

110. NDV-HXP-S

a. Manufacturer:

Icahn School of Medicine at Mount Sinai, Mahidol University

b. Vaccine Ontology ID:

VO_0005235

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Host Species as Laboratory Animal Model:

Mouse

g. Immunization Route

Intramuscular injection (i.m.)

111. Noora

a. Manufacturer:

Bagheiat-allah University of Medical Sciences

b. Vaccine Ontology ID:

VO_0005316

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

112. NVX-CoV2373

a. Tradename:

Covovax

b. Manufacturer:

Novavax

c. Vaccine Ontology ID:

VO_0005155

d. CDC CVX code:

211

e. CDC CVX description:

SARS-COV-2 (COVID-19) vaccine, Subunit, recombinant spike protein-nanoparticle+Matrix-M1 Adjuvant, preservative free, 0.5mL per dose

f. Type:

Subunit vaccine

g. Status:

Clinical trial

h. Host Species for Licensed Use:

Human

i. Antigen

SARS-CoV-2 spike (S) glycoprotein (Keech et al., 2020)

j. Immunization Route

Intramuscular injection (i.m.)

k. Description

A recombinant severe acute respiratory syndrome coronavirus 2 (rSARS-CoV-2) nanoparticle vaccine composed of trimeric full-length SARS-CoV-2 spike glycoproteins and Matrix-M1 adjuvant. (Keech et al., 2020)

l. Mouse Response

Vaccination Protocol: Groups of mice were immunized with a dose range (0.01 μg, 0.1 μg, 1 μg, and 10 μg) of NVX-CoV2373 with 5 μg Matrix-M adjuvant using a single priming dose or a prime/boost regimen spaced 14 days apart. (Tian et al., 2021)
Immune Response: Animals immunized with a single priming dose of 0.1–10 μg NVX-CoV2373/Matrix-M had elevated anti-S IgG titers that were detected 21–28 days after a single immunization. Mice immunized with 10 μg NVX-CoV2373/Matrix-M induced antibodies that blocked hACE2 receptor binding to S-protein and virus neutralizing antibodies 21–28 days after a single priming dose. Animals immunized with the prime/boost regimen had significantly elevated anti-S IgG titers that were detected 7–16 days following the booster immunization across all dose levels. Animals immunized with 1 μg and 10 μg NVX-CoV2373/Matrix-M had similar high anti-S IgG titers following immunization (geometric mean titer, GMT = 139,000 and 84,000, respectively). Importantly, mice immunized with 0.1 μg, 1 μg, or 10 μg NVX-CoV/Matrix-M had significantly (p ≤ 0.00006) higher anti-S IgG titers compared to mice immunized with 10 μg NVX-CoV2373 without adjuvant. Immunization with two doses of NVX-CoV2373/Matrix-M elicited high titer antibodies that blocked hACE2 receptor binding to S-protein (IC50 = 218–1642) and neutralized the cytopathic effect (CPE) of SARS-CoV-2 on Vero E6 cells (100% blocking of CPE = 7680–20,000) across all dose levels. (Tian et al., 2021)
Challenge Protocol: Mice were immunized with a single priming dose or a prime/boost regimen with NVX-CoV2373/Matrix-M as described above. Since mice do not support replication of WT SARS-CoV-2 virus, BALB/c mice were transduced with adenovirus encoding human ACE2 receptor (Ad/hACE2) which renders them permissive to infection with SARS-CoV-2 (refs. 21,22). At 4 days post transduction, mice were challenged with 105 plaque forming units (pfu)/mouse of SARS-CoV-2 (WA1 strain). Following challenge, mice were weighed daily and pulmonary histology and viral load were analyzed at 4 and 7 days post challenge. (Tian et al., 2021)
Efficacy: At 4 days post infection (dpi), placebo-treated mice had an average of 104 SARS-CoV-2 pfu/lung, while the mice immunized with NVX-CoV2373 without Matrix-M had 103 pfu/lung and those with Matrix-M had limited to no detectable virus load. The NVX-CoV2373 with Matrix-M prime-only groups of mice exhibited a dose-dependent reduction in virus titer, with recipients of the 10 μg dose having no detectable virus at day 4 post infection. Mice receiving 1 μg, 0.1 μg, and 0.01 μg doses all showed a marked reduction in titer compared to placebo-vaccinated mice. In the prime/boost groups, mice immunized with 10 μg, 1 μg, and 0.1 μg doses had almost undetectable lung virus loads. These results confirmed that NVX-CoV2373 confers protection against SARS-CoV-2 and that low doses of the vaccine associated with lower serologic responses do not exacerbate weight loss or induce exaggerated illness. (Tian et al., 2021)

113. Omicron COVID-19 inactivated vaccine by China National Biotec Group Company Limited

a. Manufacturer:

China National Biotec Group Company Limited

b. Vaccine Ontology ID:

VO_0005417

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

114. Osvid-19

a. Manufacturer:

Osve Pharmaceutical Company

b. Vaccine Ontology ID:

VO_0005399

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

115. Oxford-AstraZeneca COVID-19 vaccine

a. Product Name:

ChAdOx1 nCoV19 vaccine

b. Tradename:

AZD1222

c. Manufacturer:

AstraZeneca

d. Vaccine Ontology ID:

VO_0005158

e. CDC CVX code:

210

f. CDC CVX description:

SARS-COV-2 (COVID-19) vaccine, vector non-replicating, recombinant spike protein-ChAdOx1, preservative free, 0.5 mL

g. Type:

Recombinant vector vaccine

h. Status:

Clinical trial

i. Host Species for Licensed Use:

Human

j. Antigen

SARS-CoV-2 spike protein (Folegatti et al., 2020)

k. Vector:

chimpanzee adenovirus-vectored vaccine (ChAdOx1) (Folegatti et al., 2020)

l. Immunization Route

Intramuscular injection (i.m.)

m. Description

A chimpanzee adenovirus-vectored vaccine (ChAdOx1 nCoV-19) expressing the SARS-CoV-2 spike protein (Folegatti et al., 2020)

n. Macaque Response

Vaccination Protocol: Six animals per group were vaccinated using a prime-only regimen (28 days before challenge) or a prime–boost regimen (56 and 28 days before challenge) intramuscularly with 2.5 × 1010 ChAdOx1 nCoV-19 virus particles each. As a control, six animals were vaccinated via the same route with the same dose of ChAdOx1 GFP. (van et al., 2020)
Immune Response: Spike-specific antibodies were present as early as 14 days after vaccination and were significantly increased after the second immunization. Endpoint IgG titres of 400–6,400 (prime) and 400–19,200 (prime–boost) were measured on the day of challenge. Virus-specific neutralizing antibodies were also significantly increased after secondary immunization and detectable in all vaccinated animals before challenge (5–40 (prime) and 10–160 (prime–boost)), whereas no virus-specific neutralizing antibodies were detected in control animals. IgM antibodies were present in the serum after vaccination on the day of the challenge in six out of six prime–boost and two out of six prime-only animals. SARS-CoV-2 spike-specific T cell responses were detected on the day of challenge. No statistically significant difference in the magnitude of the response was found between the prime–boost and prime-only group. Vaccination with ChAdOx1 nCoV-19 resulted in the induction of neutralizing antibodies against the vaccine vector itself within 28 days of vaccination. A boost vaccination with ChAdOx1 nCoV-19 resulted in a significant increase in binding and neutralizing antibodies in NHPs and an increase in the SARS-CoV-2 virus-neutralizing titre was not significantly correlated with the ChAdOx1 virus-neutralizing titre. (van et al., 2020)
Side Effects: No adverse events were observed after vaccination. (van et al., 2020)
Challenge Protocol: Rhesus macaques were challenged with a 50% tissue culture infective dose (TCID50) of 2.6 × 106 of SARS-CoV-2 in both the upper and lower respiratory tracts.
Efficacy: Viral gRNA and sgRNA were detected in only two vaccinated animals on 3 d.p.i., and the viral load was significantly lower. Viral gRNA was detected in nose swabs from all animals and no difference was found on any day between vaccinated and control animals. Viral sgRNA was detected in a minority of samples, with no difference between groups. Infectious virus could only be detected at 1 and 3 d.p.i. in prime-only vaccinated and control animals, and 1 d.p.i. in prime–boost vaccinated animals. (van et al., 2020)

o. Human Response

Vaccination Protocol: Healthy adults aged 18-55 years with no history of laboratory confirmed SARS-CoV-2 infection or of COVID-19-like symptoms were randomly assigned (1:1) to receive ChAdOx1 nCoV-19 at a dose of 5 × 1010 viral particles or MenACWY as a single intramuscular injection. A protocol amendment in two of the five sites allowed prophylactic paracetamol to be administered before vaccination. Ten participants assigned to a non-randomised, unblinded ChAdOx1 nCoV-19 prime-boost group received a two-dose schedule, with the booster vaccine administered 28 days after the first dose. (Folegatti et al., 2020)
Immune Response: In the ChAdOx1 nCoV-19 group, spike-specific T-cell responses peaked on day 14 (median 856 spot-forming cells per million peripheral blood mononuclear cells, IQR 493-1802; n=43). Anti-spike IgG responses rose by day 28 (median 157 ELISA units [EU], 96-317; n=127), and were boosted following a second dose (639 EU, 360-792; n=10). Neutralising antibody responses against SARS-CoV-2 were detected in 32 (91%) of 35 participants after a single dose when measured in MNA80 and in 35 (100%) participants when measured in PRNT50. After a booster dose, all participants had neutralising activity (nine of nine in MNA80 at day 42 and ten of ten in Marburg VN on day 56). Neutralising antibody responses correlated strongly with antibody levels measured by ELISA (R2=0·67 by Marburg VN; p<0·001). (Folegatti et al., 2020)
Side Effects: Local and systemic reactions were more common in the ChAdOx1 nCoV-19 group and many were reduced by use of prophylactic paracetamol, including pain, feeling feverish, chills, muscle ache, headache, and malaise (all p<0·05). There were no serious adverse events related to ChAdOx1 nCoV-19. (Folegatti et al., 2020)

116. PIKA Recombinant COVID-19 Vaccine

a. Manufacturer:

Yisheng Biopharma

b. Vaccine Ontology ID:

VO_0005345

c. Type:

Subunit vaccine

d. Status:

Licensed

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

117. Prime-2-CoV_Beta

a. Manufacturer:

Speransa Therapeutics

b. Vaccine Ontology ID:

VO_0005400

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

118. PTX-COVID19-B

a. Manufacturer:

Providence Therapeutics

b. Vaccine Ontology ID:

VO_0005236

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

119. QazCoVac-P

a. Manufacturer:

Research Institute for Biological Safety Problems

b. Vaccine Ontology ID:

VO_0005273

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

120. QazVac

a. Product Name:

QazCovid-in

b. Manufacturer:

Research Institute for Biological Safety Problems, National Scientific Center for Phthisiopulmonology of the Republic of Kazakhstan

c. Vaccine Ontology ID:

VO_0005093

d. Type:

Inactivated or "killed" vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

121. Razi Cov Pars

a. Manufacturer:

Razi Vaccine and Serum Research Institute

b. Vaccine Ontology ID:

VO_0005226

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

122. RBD-HBsAg VLP

a. Manufacturer:

Serum Institute of India, Accelegen Pty

b. Vaccine Ontology ID:

VO_0005094

c. Type:

Virus Like Particle

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

123. Recombinant SARS-CoV-2 vaccine (Sf9 cell)

a. Manufacturer:

West China Hospital, Sichuan University

b. Vaccine Ontology ID:

VO_0005095

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

124. ReCOV

a. Manufacturer:

Jiangsu Rec-Biotechnology

b. Vaccine Ontology ID:

VO_0005252

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

Recombinant two-component spike and RBD protein (CHO cell)

g. Immunization Route

Intramuscular injection (i.m.)

125. RH109

a. Manufacturer:

Wuhan Recogen Biotechnology Co., Ltd.

b. Vaccine Ontology ID:

VO_0005401

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

126. RQ3013

a. Manufacturer:

Walvax Biotechnology, Shanghai RNACure Biopharma

b. Vaccine Ontology ID:

VO_0005403

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

127. RVM-V001

a. Manufacturer:

RVAC Medicines

b. Type:

RNA vaccine

c. Status:

Clinical trial

d. Host Species for Licensed Use:

Human

e. Immunization Route

Intramuscular injection (i.m.)

128. S-268019

a. Manufacturer:

Shionogi

b. Vaccine Ontology ID:

VO_0005096

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Description

The vaccine S-268019-b is a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike (S)-protein vaccine consisting of full-length recombinant SARS-CoV-2 S-protein (S-910823) as antigen, mixed with the squalene-based adjuvant A-910823 (Hashimoto et al., 2022)

h. Monkey Response

Immune Response: Two weeks after the second dosing, dose-dependent humoral immune responses were observed with neutralizing antibody titers being comparable to that of human convalescent plasma. (Hashimoto et al., 2022)
Side Effects: No adverse clinical signs or weight loss associated with the vaccine were observed, suggesting safety of the vaccine in cynomolgus monkeys.

129. SARS-CoV-2 Vaccine YF-S0

a. Type:

Live, attenuated vaccine

b. Status:

Research

c. Host Species for Licensed Use:

None

d. Host Species as Laboratory Animal Model:

Hamster

e. Antigen

S protein of SARS-CoV-2 (Sanchez-Felipe et al., 2021)

f. Gene Engineering of spike (S) protein

Type: Recombinant vector construction
Description: (Sanchez-Felipe et al., 2021)
Detailed Gene Information: Click here.

g. Vector:

YF17D (Sanchez-Felipe et al., 2021)

h. Preparation

Using an advanced reverse genetics system, a panel of YF17D-based candidate vaccines (YF-S) that express the S protein of SARS-CoV-2 in its noncleavable S0 version was generated.

i. Immunization Route

Intraperitoneal injection (i.p.)

j. Description

A single-dose live-attenuated YF17D-vectored SARS-CoV-2 vaccine protects hamsters against SARS-CoV-2 challenge. (Sanchez-Felipe et al., 2021)

k. Hamster Response

Vaccination Protocol: Hamsters were vaccinated at day 0 with a low dose of 10^3 PFU (via the intraperitoneal route) of the different constructs or YF17D and sham (as negative controls), and boosted after 7 days. (Sanchez-Felipe et al., 2021)
Immune Response: At day 21, all hamsters vaccinated with YF-S1/2 and YF-S0 had seroconverted to high levels of S-specific IgG and virus NAbs with log10-transformed geometric mean titres for YF-S0 of 3.5 (95% confidence interval of 3.3–3.8) for IgG and 2.2 (95% confidence interval of 1.9–2.6) for NAbs, with rapid seroconversion kinetics. (Sanchez-Felipe et al., 2021)
Challenge Protocol: After 23 or 28 days, hamsters were challenged intranasally with 2 × 10^5 PFU of SARS-CoV-2. (Sanchez-Felipe et al., 2021)
Efficacy: Four days after infection, we detected high viral loads in the lungs of sham-vaccinated controls and hamsters vaccinated with YF17D as a matched placebo. Hamsters vaccinated with YF-S0 were protected against this aggressive challenge, with a median reduction of 5 log10-transformed viral RNA loads (interquartile range (IQR) of 4.5–5.4) in viral RNA loads, and of 5.3 log10-transformed virus titre (IQR of 3.9–6.3) for infectious virus in the lungs as compared to sham. (Sanchez-Felipe et al., 2021)

130. SARS-CoV-2 VLP Vaccine

a. Manufacturer:

The Scientific and Technological Research Council of Turkey

b. Vaccine Ontology ID:

VO_0005251

c. Type:

Virus like particle

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

subcutaneous injection

131. SC-Ad6-1

a. Manufacturer:

Tetherex Pharmaceuticals Corporation

b. Vaccine Ontology ID:

VO_0005254

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Vector:

Adneviral vector

g. Immunization Route

Intramuscular injection (i.m.)

132. SCB-2019

a. Manufacturer:

Clover Biopharmaceuticals, GSK, Dynavax

b. Vaccine Ontology ID:

VO_0004994

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Baboon Response

Immune Response: . SCB-2019 with no adjuvant elicited minimal immune responses (three seroconversions by day 50), but SCB-2019 with fixed doses of either AS03 or CpG/Alum adjuvants induced high titres and seroconversion rates of binding and neutralising antibodies in both younger and older adults (Richmond et al., 2021)
Side Effects: Most local adverse events were mild injection-site pain (Richmond et al., 2021)

133. SCB-2020S

a. Manufacturer:

Clover Biopharmaceuticals AUS Pty Ltd

b. Vaccine Ontology ID:

VO_0005315

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

134. SCTV01C

a. Manufacturer:

Sinocelltech Ltd.

b. Vaccine Ontology ID:

VO_0005337

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

135. SII B.1.351

a. Manufacturer:

Novavax

b. Vaccine Ontology ID:

VO_0005333

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

136. SII B.1.617.2

a. Manufacturer:

Novavax

b. Vaccine Ontology ID:

VO_0005335

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

137. SII Bivalent

a. Manufacturer:

Novavax

b. Vaccine Ontology ID:

VO_0005334

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

138. SKYCovione

a. Manufacturer:

SK Bioscience Co., Ltd.

b. Vaccine Ontology ID:

VO_0005197

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

139. Soberana 02

a. Product Name:

FINLAY-FR-2

b. Manufacturer:

Instituto Finlay de Vacunas

c. Vaccine Ontology ID:

VO_0005097

d. Type:

Subunit vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

140. Soberana Plus

a. Manufacturer:

Instituto Finlay de Vacunas

b. Vaccine Ontology ID:

VO_0005244

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

141. SpFN

a. Manufacturer:

Walter Reed Army Institute of Research

b. Vaccine Ontology ID:

VO_0005237

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

142. Sputnik V

a. Product Name:

Gam-COVID-Vac

b. Vaccine Ontology ID:

VO_0005168

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

spike (S) protein (Logunov et al., 2020)

g. Vector:

recombinant adenovirus 26 and recombinant adenovirus 5 (Logunov et al., 2020)

h. Immunization Route

Intramuscular injection (i.m.)

i. Description

A SARS-CoV-2 recombinant viral vector vaccine composed of Ad26 and Ad5 vectors expressing S protein that lyophilised (Logunov et al., 2020).

143. SYS6006

a. Manufacturer:

CSPC ZhongQi Pharmaceutical Technology Co., Ltd.

b. Vaccine Ontology ID:

VO_0005410

c. Type:

mRNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Mouse Response

Immune Response: Two rounds of immunization with SYS6006 were able to induce the neutralizing antibodies against the SARS-CoV-2 wild-type (WT) strain, and Delta and Omicron BA.2 variants in mice or non-human primates (NHPs). A3rd round of vaccination could further enhance the titers of neutralization against Delta and Omicron variants. (Xu et al., 2023)

144. Turkovac

a. Product Name:

ERUCOV-VAC

b. Manufacturer:

Erciyes University

c. Vaccine Ontology ID:

VO_0005188

d. Type:

Inactivated or "killed" vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

145. UB-612

a. Manufacturer:

Vaxxinity

b. Vaccine Ontology ID:

VO_0004995

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Efficacy: Based on the receptor-binding domain protein binding antibody responses, the UB-612 third-dose booster may lead to an estimated approximately 95% efficacy against symptomatic COVID-19 caused by the ancestral strain.(Guirakhoo et. al 2022)

146. UNAIR Inactivated COVID-19 Vaccine

a. Manufacturer:

Airlangga University

b. Vaccine Ontology ID:

VO_0005411

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

147. V-01

a. Manufacturer:

Livzon Mabpharm Inc.

b. Vaccine Ontology ID:

VO_0005247

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Human Response

Immune Response: A dramatic increase (11.3-fold; 128.3-1452.8) of neutralizing titres was measured in the V-01 group at 14 days after the booster. Over two months of surveillance, vaccine efficacy was 47.8% (95%CI: 22.6-64.7) according to the intention-to-treat principle. (Wang et al. 2022)
Side Effects: The most common adverse events were transient, mild-to-moderate pain at the injection site, fever, headache, and fatigue. (Wang et al. 2022)

148. V-01-351/V-01D Bivalence Vaccine

a. Manufacturer:

Livzon Pharmaceutical Group Inc.

b. Vaccine Ontology ID:

VO_0005412

c. Type:

Subunit vaccine

d. Status:

Licensed

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

g. Baboon Response

Efficacy: In particular, V-01D-351 booster showed the highest pseudovirus neutralizing antibody titers against prototype SARS-CoV-2, Delta and Omicron BA.1 strains at day 14 post boosting, with GMTs 22.7, 18.3, 14.3 times higher than ICV booster, 6.2, 6.1, 3.8 times higher than V-01 booster (10 μg), and 5.2, 3.8, 3.5 times higher than V-01 booster (25 μg), respectively (Zhang et al., 2022).

149. VAT00002

a. Product Name:

CoV2 preS dTM

b. Manufacturer:

Sanofi Pasteur, GSK

c. Vaccine Ontology ID:

VO_0005085

d. Type:

Subunit vaccine

e. Status:

Clinical trial

f. Host Species for Licensed Use:

Human

g. Immunization Route

Intramuscular injection (i.m.)

150. VB10.2129

a. Manufacturer:

Vaccibody AS

b. Vaccine Ontology ID:

VO_0005340

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

151. VB10.2210

a. Manufacturer:

Vaccibody AS

b. Vaccine Ontology ID:

VO_0005341

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

152. VBI-2902a

a. Manufacturer:

VBI Vaccines Inc.

b. Vaccine Ontology ID:

VO_0005238

c. Type:

Virus Like Particle

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

SARS-CoV-2 spike glycoprotein (S protein) (NCT04773665)

g. Immunization Route

Intramuscular injection (i.m.)

h. Baboon Response

Immune Response: Antibody binding and neutralization titers were undiminished for more than 3 months after a single immunization. A single dose of this candidate, named VBI-2902a, protected Syrian golden hamsters from challenge with SARS-CoV-2 and supports the on-going clinical evaluation of VBI-2902a as a highly potent vaccine against COVID-19. (Fluckiger et al., 2021)

153. VLA2001

a. Manufacturer:

Valneva, National Institute for Health Research (United Kingdom)

b. Vaccine Ontology ID:

VO_0005099

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intramuscular injection (i.m.)

154. VLPCOV-01

a. Manufacturer:

VLP Therapeutics Japan GK

b. Type:

mRNA vaccine

c. Status:

Clinical trial

d. Host Species for Licensed Use:

Human

e. Immunization Route

Intramuscular injection (i.m.)

155. VXA-CoV2-1

a. Manufacturer:

Vaxart

b. Vaccine Ontology ID:

VO_0005196

c. Type:

Recombinant vector vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Oral

g. Hamster Response

Immune Response: Hamsters administered 2 doses of VXA-CoV2-1 showed a reduction in weight loss and lung pathology and had completely eliminated infectious virus 5 days postchallenge. Oral immunization induced antispike immunoglobulin G, and neutralizing antibodies were induced upon oral immunization with the sera, demonstrating neutralizing activity. (Johnson et al., 2022)
Efficacy: Overall, these data demonstrate the ability of oral vaccine candidate VXA-CoV2-1 to provide protection against SARS-CoV-2 disease. (Johnson et al., 2022)

156. VXS-1223

a. Manufacturer:

Vaxxas Pty Ltd

b. Vaccine Ontology ID:

VO_0005404

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Immunization Route

Intradermal injection (i.d.)

157. WIBP-CorV

a. Manufacturer:

Wuhan Institute of Biological Products

b. Vaccine Ontology ID:

VO_0005160

c. Type:

Inactivated or "killed" vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

whole virus (Xia et al., 2020)

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

An investigational inactivated whole-virus COVID-19 vaccine (Xia et al., 2020)

158. ZF2001

a. Tradename:

RBD-Dimer

b. Vaccine Ontology ID:

VO_0005142

c. Type:

Subunit vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Host Species as Laboratory Animal Model:

Mouse

g. Immunization Route

Intramuscular injection (i.m.)

h. Description

A SARS-CoV-2 vaccine made of an SARS-CoV-2 RBD-sc-dimer (Dai et al., 2020)

i. Mouse Response

Host Strain: Balb/c
Vaccination Protocol: Mice were immunized by subcutaneous injection with 50 μg of RBD-CuMVTT ((Zha, et al., 2020))
Immune Response: Induced neutralizing antibodies, production of RBD-Specific antibodies ((Zha, et al., 2020))

159. ZyCoV-D

a. Manufacturer:

Zydus Cadila

b. Vaccine Ontology ID:

VO_0005162

c. Type:

DNA vaccine

d. Status:

Clinical trial

e. Host Species for Licensed Use:

Human

f. Antigen

envelope protein (Kaur and Gupta, 2020)

g. Vector:

DNA plasmid (Kaur and Gupta, 2020)

h. Immunization Route

Intramuscular injection (i.m.)

i. Description

A SARS-CoV2 plasmid DNA vaccine that encodes the envelope protein (Kaur and Gupta, 2020).

IV. References

1. ACTRN12620000674932: A Phase 1 Randomised, Double-Blind, Placebo-Controlled, Dosage-Escalation, Single Centre Study To Evaluate The Safety And Immunogenicity Of An Adjuvanted SARS-CoV-2 Sclamp Protein Subunit Vaccine (COVID-19 vaccine) In Healthy Adults Aged 18 To 55 Years Old [https://www.anzctr.org.au/Trial/Registration/TrialReview.aspx?id=379861&isReview=true]

2. Agrati et. al 2021: Chiara Agrati , Stefania Capone , Concetta Castilletti, Eleonora Cimini, Giulia Matusali, Silvia Meschi, Eleonora Tartaglia, Roberto Camerini, Simone Lanini, Stefano Milleri, Stefano Colloca, Alessandra Vitelli, Antonella Folgori. Strong immunogenicity of heterologous prime-boost immunizations with the experimental vaccine GRAd-COV2 and BNT162b2 or ChAdOx1-nCOV19. . ; ; . [PubMed: 34737309].

3. Ahn et. al 2022: Jin Young Ahn, Jeongsoo Lee, You Suk Suh, Young Goo Song, Yoon-Jeong Choi, Kyoung Hwa Lee, Sang Hwan Seo, Manki Song, Jong-Won Oh, Minwoo Kim, Han Yeong Seo, Jeong-Eun Kwak, Jin Won Youn, Jung Won Woo, Eui-Cheol Shin, Young Chul Sung, Su-Hyung Park, Jun Yong Choi. afety and immunogenicity of two recombinant DNA COVID-19 vaccines containing the coding regions of the spike or spike and nucleocapsid proteins: an interim analysis of two open-label, non-randomised, phase 1 trials in healthy adults. . 2022; ; . [PubMed: 35156068/].

4. Ali et al., 2021: Kashif Ali 1, Gary Berman 1, Honghong Zhou 1, Weiping Deng 1, Veronica Faughnan 1, Maria Coronado-Voges 1, Baoyu Ding 1, Jacqueline Dooley 1, Bethany Girard 1, William Hillebrand 1, Rolando Pajon 1, Jacqueline M Miller 1, Brett Leav 1, Roderick McPhee 1. Evaluation of mRNA-1273 SARS-CoV-2 Vaccine in Adolescents. . 2021; ; . [PubMed: 34379915].

5. Anderson et al., 2020: Anderson EJ, Rouphael NG, Widge AT, Jackson LA, Roberts PC, Makhene M, Chappell JD, Denison MR, Stevens LJ, Pruijssers AJ, McDermott AB, Flach B, Lin BC, Doria-Rose NA, O'Dell S, Schmidt SD, Corbett KS, Swanson PA 2nd, Padilla M, Neuzil KM, Bennett H, Leav B, Makowski M, Albert J, Cross K, Edara VV, Floyd K, Suthar MS, Martinez DR, Baric R, Buchanan W, Luke CJ, Phadke VK, Rostad CA, Ledgerwood JE, Graham BS, Beigel JH. Safety and Immunogenicity of SARS-CoV-2 mRNA-1273 Vaccine in Older Adults. The New England journal of medicine. 2020; 383(25); 2427-2438. [PubMed: 32991794].

6. Bourinbayar, 2020: Tableted COVID-19 Therapeutic Vaccine (COVID-19) [https://clinicaltrials.gov/ct2/show/NCT04380532]

7. Chalkias et al., 2022: Spyros Chalkias 1, Charles Harper 1, Keith Vrbicky 1, Stephen R Walsh 1, Brandon Essink 1, Adam Brosz 1, Nichole McGhee 1, Joanne E Tomassini 1, Xing Chen 1, Ying Chang 1, Andrea Sutherland 1, David C Montefiori 1, Bethany Girard 1, Darin K Edwards 1, Jing Feng 1, Honghong Zhou 1, Lindsey R Baden 1, Jacqueline M Miller 1, Rituparna Das 1. A Bivalent Omicron-Containing Booster Vaccine against Covid-19. . 2022; ; . [PubMed: 36112399].

8. Chappell et al., 2021: Chappell KJ, Mordant FL, Li Z, Wijesundara DK, Ellenberg P, Lackenby JA, Cheung STM, Modhiran N, Avumegah MS, Henderson CL, Hoger K, Griffin P, Bennet J, Hensen L, Zhang W, Nguyen THO, Marrero-Hernandez S, Selva KJ, Chung AW, Tran MH, Tapley P, Barnes J, Reading PC, Nicholson S, Corby S, Holgate T, Wines BD, Hogarth PM, Kedzierska K, Purcell DFJ, Ranasinghe C, Subbarao K, Watterson D, Young PR, Munro TP. Safety and immunogenicity of an MF59-adjuvanted spike glycoprotein-clamp vaccine for SARS-CoV-2: a randomised, double-blind, placebo-controlled, phase 1 trial. The Lancet. Infectious diseases. 2021; ; . [PubMed: 33887208].

9. ChiCTR2000032459: Evaluation of the safety and immunogenicity of inactivated novel coronavirus (2019-CoV) vaccine (Vero cells) in healthy population aged 3 years and above: a randomized, double-blind, placebo parallel-controlled phase I/II clinical trial [www.chictr.org.cn/hvshowproject.aspx?id=48144]

10. ChiCTR2000034112: A Phase I clinical trial to evaluate the safety, tolerance and preliminary immunogenicity of different doses of a SARS-CoV-2 mRNA vaccine in population aged 18-59 years and 60 years and above [http://www.chictr.org.cn/historyversionpuben.aspx?regno=ChiCTR2000034112]

11. Corbett et al., 2020: Corbett KS, Flynn B, Foulds KE, Francica JR, Boyoglu-Barnum S, Werner AP, Flach B, O'Connell S, Bock KW, Minai M, Nagata BM, Andersen H, Martinez DR, Noe AT, Douek N, Donaldson MM, Nji NN, Alvarado GS, Edwards DK, Flebbe DR, Lamb E, Doria-Rose NA, Lin BC, Louder MK, O'Dell S, Schmidt SD, Phung E, Chang LA, Yap C, Todd JM, Pessaint L, Van Ry A, Browne S, Greenhouse J, Putman-Taylor T, Strasbaugh A, Campbell TA, Cook A, Dodson A, Steingrebe K, Shi W, Zhang Y, Abiona OM, Wang L, Pegu A, Yang ES, Leung K, Zhou T, Teng IT, Widge A, Gordon I, Novik L, Gillespie RA, Loomis RJ, Moliva JI, Stewart-Jones G, Himansu S, Kong WP, Nason MC, Morabito KM, Ruckwardt TJ, Ledgerwood JE, Gaudinski MR, Kwong PD, Mascola JR, Carfi A, Lewis MG, Baric RS, McDermott A, Moore IN, Sullivan NJ, Roederer M, Seder RA, Graham BS. Evaluation of the mRNA-1273 Vaccine against SARS-CoV-2 in Nonhuman Primates. The New England journal of medicine. 2020; 383(16); 1544-1555. [PubMed: 32722908].

12. CTRI/2020/07/026352: A prospective, randomized, adaptive, phase I/II clinical study to evaluate the safety andimmunogenicity of Novel Corona Virus -2019-nCov vaccine candidate of M/s Cadila HealthcareLimited by intradermal route in healthy subject [http://ctri.nic.in/Clinicaltrials/pdf_generate.php?trialid=45306&EncHid=&modid=&compid=%27,%2745306det%27]

13. Dai et al., 2020: Dai L, Zheng T, Xu K, Han Y, Xu L, Huang E, An Y, Cheng Y, Li S, Liu M, Yang M, Li Y, Cheng H, Yuan Y, Zhang W, Ke C, Wong G, Qi J, Qin C, Yan J, Gao GF. A Universal Design of Betacoronavirus Vaccines against COVID-19, MERS, and SARS. Cell. 2020; 182(3); 722-733.e11. [PubMed: 32645327].

14. Ella et al., 2021: Ella R, Vadrevu KM, Jogdand H, Prasad S, Reddy S, Sarangi V, Ganneru B, Sapkal G, Yadav P, Abraham P, Panda S, Gupta N, Reddy P, Verma S, Kumar Rai S, Singh C, Redkar SV, Gillurkar CS, Kushwaha JS, Mohapatra S, Rao V, Guleria R, Ella K, Bhargava B. Safety and immunogenicity of an inactivated SARS-CoV-2 vaccine, BBV152: a double-blind, randomised, phase 1 trial. The Lancet. Infectious diseases. 2021; 21(5); 637-646. [PubMed: 33485468].

15. Erasmus et al., 2020: Erasmus JH, Khandhar AP, O'Connor MA, Walls AC, Hemann EA, Murapa P, Archer J, Leventhal S, Fuller JT, Lewis TB, Draves KE, Randall S, Guerriero KA, Duthie MS, Carter D, Reed SG, Hawman DW, Feldmann H, Gale M Jr, Veesler D, Berglund P, Fuller DH. An Alphavirus-derived replicon RNA vaccine induces SARS-CoV-2 neutralizing antibody and T cell responses in mice and nonhuman primates. Science translational medicine. 2020; 12(555); . [PubMed: 32690628].

16. Fluckiger et al., 2021: Anne-Catherine Fluckiger 1, Barthelemy Ontsouka 2, Jasminka Bozic 2, Abebaw Diress 2, Tanvir Ahmed 2, Tamara Berthoud 2, Anh Tran 3, Diane Duque 3, Mingmin Liao 4, Michael McCluskie 3, Francisco Diaz-Mitoma 5, David E Anderson 5, Catalina Soare 2. An enveloped virus-like particle vaccine expressing a stabilized prefusion form of the SARS-CoV-2 spike protein elicits highly potent immunity. . 2021; ; . [PubMed: 34304928].

17. Folegatti et al., 2020: Folegatti PM, Ewer KJ, Aley PK, Angus B, Becker S, Belij-Rammerstorfer S, Bellamy D, Bibi S, Bittaye M, Clutterbuck EA, Dold C, Faust SN, Finn A, Flaxman AL, Hallis B, Heath P, Jenkin D, Lazarus R, Makinson R, Minassian AM, Pollock KM, Ramasamy M, Robinson H, Snape M, Tarrant R, Voysey M, Green C, Douglas AD, Hill AVS, Lambe T, Gilbert SC, Pollard AJ. Safety and immunogenicity of the ChAdOx1 nCoV-19 vaccine against SARS-CoV-2: a preliminary report of a phase 1/2, single-blind, randomised controlled trial. Lancet (London, England). 2020; ; . [PubMed: 32702298].

18. Gao et al., 2020: Gao Q, Bao L, Mao H, Wang L, Xu K, Yang M, Li Y, Zhu L, Wang N, Lv Z, Gao H, Ge X, Kan B, Hu Y, Liu J, Cai F, Jiang D, Yin Y, Qin C, Li J, Gong X, Lou X, Shi W, Wu D, Zhang H, Zhu L, Deng W, Li Y, Lu J, Li C, Wang X, Yin W, Zhang Y, Qin C. Rapid development of an inactivated vaccine candidate for SARS-CoV-2. Science (New York, N.Y.). 2020; ; . [PubMed: 32376603].

19. González-Domínguez et al., 2022: Irene González-Domínguez 1, Jose Luis Martínez 1, Stefan Slamanig 1, Nicholas Lemus 1, Yonghong Liu 1, Tsoi Ying Lai 1, Juan Manuel Carreño 1, Gagandeep Singh A 1, Gagandeep Singh B 1 2, Michael Schotsaert 1 2, Ignacio Mena 1 2, Stephen McCroskery 1, Lynda Coughlan 3 4, Florian Krammer 1 5, Adolfo García-Sastre 1 2 5 6 7, Peter Palese 1 6, Weina Sun 1. Trivalent NDV-HXP-S vaccine protects against phylogenetically distant SARS-CoV-2 variants of concern in mice. . ; ; . [PubMed: 35350201].

20. GRAd-COV2: GRAd-COV2 [https://www.covidx.eu/grad-cov2]

21. Guirakhoo et. al 2022: Farshad Guirakhoo 1, Shixia Wang 1, Chang Yi Wang 2, Hui Kai Kuo 2, Wen Jiun Peng 2, Hope Liu 2, Lixia Wang 1, Marina Johnson 3, Adam Hunt 3, Mei Mei Hu 1, Thomas P Monath 1, Alexander Rumyantsev 1, David Goldblatt 3. High Neutralizing Antibody Levels Against Severe Acute Respiratory Syndrome Coronavirus 2 Omicron BA.1 and BA.2 After UB-612 Vaccine Booster. . 2022; ; . [PubMed: 35723969].

22. Hashimoto et al., 2022: Masayuki Hashimoto 1, Noriyo Nagata 2, Tomoyuki Homma 3, Hiroki Maeda 4, Keiji Dohi 5, Naomi M Seki 6, Ken Yoshihara 7, Naoko Iwata-Yoshikawa 8, Nozomi Shiwa-Sudo 9, Yusuke Sakai 10, Masayuki Shirakura 11, Noriko Kishida 12, Tomoko Arita 13, Yasushi Suzuki 14, Shinji Watanabe 15, Hideki Asanuma 16, Takuhiro Sonoyama 17, Tadaki Suzuki 18, Shinya Omoto 19, Hideki Hasegawa 20. Immunogenicity and protective efficacy of SARS-CoV-2 recombinant S-protein vaccine S-268019-b in cynomolgus monkeys. . 2022; ; . [PubMed: 35691872].

23. Hassan et. al 2020: Hassan AO, Kafai NM, Dmitriev IP, Fox JM, Smith BK, Harvey IB, Chen RE, Winkler ES, Wessel AW, Case JB, Kashentseva E, McCune BT, Bailey AL, Zhao H, VanBlargan LA, Dai YN, Ma M, Adams LJ, Shrihari S, Danis JE, Gralinski LE, Hou YJ, Schafer A, Kim AS, Keeler SP, Weiskopf D, Baric RS, Holtzman MJ, Fremont DH, Curiel DT, Diamond MS. A Single-Dose Intranasal ChAd Vaccine Protects Upper and Lower Respiratory Tracts against SARS-CoV-2. . 2020; ; . [PubMed: 32931734].

24. ISRCTN17072692: Clinical trial to assess the safety of a coronavirus vaccine in healthy men and women [http://www.isrctn.com/ISRCTN17072692]

25. Jackson et al., 2020: Jackson LA, Anderson EJ, Rouphael NG, Roberts PC, Makhene M, Coler RN, McCullough MP, Chappell JD, Denison MR, Stevens LJ, Pruijssers AJ, McDermott A, Flach B, Doria-Rose NA, Corbett KS, Morabito KM, O'Dell S, Schmidt SD, Swanson PA 2nd, Padilla M, Mascola JR, Neuzil KM, Bennett H, Sun W, Peters E, Makowski M, Albert J, Cross K, Buchanan W, Pikaart-Tautges R, Ledgerwood JE, Graham BS, Beigel JH. An mRNA Vaccine against SARS-CoV-2 - Preliminary Report. The New England journal of medicine. 2020; ; . [PubMed: 32663912].

26. Johnson et al., 2022: Susan Johnson 1, Clarissa I Martinez 1, Sarah N Tedjakusuma 1, Nadine Peinovich 1, Emery G Dora 1, Sharla M Birch 2, Adriana E Kajon 2, Adam D Werts 2, Sean N Tucker 1. Oral Vaccination Protects Against Severe Acute Respiratory Syndrome Coronavirus 2 in a Syrian Hamster Challenge Model. . 2022; ; . [PubMed: 34758086].

27. Kaur and Gupta, 2020: Kaur SP, Gupta V. COVID-19 Vaccine: A comprehensive status report. Virus research. 2020; 288; 198114. [PubMed: 32800805].

28. Keech et al., 2020: Keech C, Albert G, Cho I, Robertson A, Reed P, Neal S, Plested JS, Zhu M, Cloney-Clark S, Zhou H, Smith G, Patel N, Frieman MB, Haupt RE, Logue J, McGrath M, Weston S, Piedra PA, Desai C, Callahan K, Lewis M, Price-Abbott P, Formica N, Shinde V, Fries L, Lickliter JD, Griffin P, Wilkinson B, Glenn GM. Phase 1-2 Trial of a SARS-CoV-2 Recombinant Spike Protein Nanoparticle Vaccine. The New England journal of medicine. 2020; ; . [PubMed: 32877576].

29. Khorattanakulchai et al., 2022: Narach Khorattanakulchai 1 2, Kanjana Srisutthisamphan 3, Balamurugan Shanmugaraj 4, Suwimon Manopwisedjaroen 5, Kaewta Rattanapisit 4, Chalisa Panapitakkul 1 2, Taratorn Kemthong 6, Nutchanat Suttisan 6, Suchinda Malaivijitnond 6, Arunee Thitithanyanont 5, Anan Jongkaewwattana 3, Waranyoo Phoolcharoen 1 2. A recombinant subunit vaccine candidate produced in plants elicits neutralizing antibodies against SARS-CoV-2 variants in macaques. . 2022; ; . [PubMed: 36247553].

30. King et al., 2020: King RG, Silva-Sanchez A, Peel JN, Botta D, Meza-Perez S, Allie R, Schultz MD, Liu M, Bradley JE, Qiu S, Yang G, Zhou F, Zumaquero E, Simpler TS, Mousseau B, Killian JT, Dean B, Shang Q, Tipper JL, Risley C, Harrod KS, Feng R, Lee Y, Shiberu B, Krishnan V, Peguillet I, Zhang J, Green T, Randall TD, Georges B, Lund FE, Roberts S. Single-dose intranasal administration of AdCOVID elicits systemic and mucosal immunity against SARS-CoV-2 in mice. bioRxiv : the preprint server for biology. 2020; ; . [PubMed: 33052351].

31. LABline, 2021: Adjuvant enhances efficacy of India’s COVID-19 vaccine [https://www.mlo-online.com/disease/infectious-disease/article/21228745/adjuvant-enhances-efficacy-of-indias-covid19-vaccine]

32. Li et al.,: Jianglong Li, Qi Liu, Jun Liu, Zihui Fang, Liping Luo,, Shuang Li, Yixin Lei, Zhi Li, Jing Jin, Ronglin Xie, Yucai Peng. Development of Bivalent mRNA Vaccines against SARS-CoV-2 Variants. . 2022; ; . [PubMed: 36366316].

33. Logunov et al., 2020: Logunov DY, Dolzhikova IV, Zubkova OV, Tukhvatullin AI, Shcheblyakov DV, Dzharullaeva AS, Grousova DM, Erokhova AS, Kovyrshina AV, Botikov AG, Izhaeva FM, Popova O, Ozharovskaya TA, Esmagambetov IB, Favorskaya IA, Zrelkin DI, Voronina DV, Shcherbinin DN, Semikhin AS, Simakova YV, Tokarskaya EA, Lubenets NL, Egorova DA, Shmarov MM, Nikitenko NA, Morozova LF, Smolyarchuk EA, Kryukov EV, Babira VF, Borisevich SV, Naroditsky BS, Gintsburg AL. Safety and immunogenicity of an rAd26 and rAd5 vector-based heterologous prime-boost COVID-19 vaccine in two formulations: two open, non-randomised phase 1/2 studies from Russia. Lancet (London, England). 2020; 396(10255); 887-897. [PubMed: 32896291].

34. McKay et al., 2020: McKay PF, Hu K, Blakney AK, Samnuan K, Brown JC, Penn R, Zhou J, Bouton CR, Rogers P, Polra K, Lin PJC, Barbosa C, Tam YK, Barclay WS, Shattock RJ. Self-amplifying RNA SARS-CoV-2 lipid nanoparticle vaccine candidate induces high neutralizing antibody titers in mice. Nature communications. 2020; 11(1); 3523. [PubMed: 32647131].

35. Mercado et al., 2020: Mercado NB, Zahn R, Wegmann F, Loos C, Chandrashekar A, Yu J, Liu J, Peter L, McMahan K, Tostanoski LH, He X, Martinez DR, Rutten L, Bos R, van Manen D, Vellinga J, Custers J, Langedijk JP, Kwaks T, Bakkers MJG, Zuijdgeest D, Rosendahl Huber SK, Atyeo C, Fischinger S, Burke JS, Feldman J, Hauser BM, Caradonna TM, Bondzie EA, Dagotto G, Gebre MS, Hoffman E, Jacob-Dolan C, Kirilova M, Li Z, Lin Z, Mahrokhian SH, Maxfield LF, Nampanya F, Nityanandam R, Nkolola JP, Patel S, Ventura JD, Verrington K, Wan H, Pessaint L, Van Ry A, Blade K, Strasbaugh A, Cabus M, Brown R, Cook A, Zouantchangadou S, Teow E, Andersen H, Lewis MG, Cai Y, Chen B, Schmidt AG, Reeves RK, Baric RS, Lauffenburger DA, Alter G, Stoffels P, Mammen M, Van Hoof J, Schuitemaker H, Barouch DH. Single-shot Ad26 vaccine protects against SARS-CoV-2 in rhesus macaques. Nature. 2020; ; . [PubMed: 32731257].

36. Mulligan et al., 2020: Mulligan MJ, Lyke KE, Kitchin N, Absalon J, Gurtman A, Lockhart S, Neuzil K, Raabe V, Bailey R, Swanson KA, Li P, Koury K, Kalina W, Cooper D, Fontes-Garfias C, Shi PY, Türeci Ö, Tompkins KR, Walsh EE, Frenck R, Falsey AR, Dormitzer PR, Gruber WC, Şahin U, Jansen KU. Phase 1/2 study of COVID-19 RNA vaccine BNT162b1 in adults. Nature. 2020; ; . [PubMed: 32785213].

37. Nakagami et al,, 2022: Hironori Nakagami, Hiroki Hayashi , Jiao Sun , Yuka Yanagida , Takako Otera , Futoshi Nakagami , Shigeto Hamaguchi , Hisao Yoshida , Hideo Okuno , Shota Yoshida , Ryo Nakamaru , Serina Yokoyama , Taku Fujimoto , Kazuhiro Hongyo , Yukihiro Akeda , Ryuichi Morishita , Kazunori Tomono , Hiromi Rakugi. Study to Assess the Safety and Immunogenicity of an Intradermal COVID-19 DNA Vaccine Administered Using a Pyro-Drive Jet Injector in Healthy Adults. . 2022; ; . [PubMed: 36146505].

38. NCT04313127: Phase I Clinical Trial of a COVID-19 Vaccine in 18-60 Healthy Adults (CTCOVID-19) [https://clinicaltrials.gov/ct2/show/NCT04313127]

39. NCT04336410: Safety, Tolerability and Immunogenicity of INO-4800 for COVID-19 in Healthy Volunteers [https://clinicaltrials.gov/ct2/show/NCT04336410]

40. NCT04368988: Evaluation of the Safety and Immunogenicity of a SARS-CoV-2 rS (COVID-19) Nanoparticle Vaccine With/Without Matrix-M Adjuvant [https://clinicaltrials.gov/ct2/show/NCT04368988]

41. NCT04405908: SCB-2019 as COVID-19 Vaccine [https://clinicaltrials.gov/ct2/show/NCT04405908]

42. NCT04412538: Safety and Immunogenicity Study of an Inactivated SARS-CoV-2 Vaccine for Preventing Against COVID-19 [https://clinicaltrials.gov/ct2/show/NCT04412538]

43. NCT04436276: A Study of Ad26.COV2.S in Adults (COVID-19) [https://clinicaltrials.gov/ct2/show/NCT04436276]

44. NCT04436471: An Open Study of the Safety, Tolerability and Immunogenicity of the Drug "Gam-COVID-Vac" Vaccine Against COVID-19 [https://clinicaltrials.gov/ct2/show/NCT04436471?term=NCT04436471&draw=2&rank=1]

45. NCT04437875: An Open Study of the Safety, Tolerability and Immunogenicity of "Gam-COVID-Vac Lyo" Vaccine Against COVID-19 [https://clinicaltrials.gov/ct2/show/NCT04437875]

46. NCT04445389: Safety and Immunogenicity Study of GX-19, a COVID-19 Preventive DNA Vaccine in Healthy Adults [https://clinicaltrials.gov/ct2/show/NCT04445389]

47. NCT04449276: A Study to Evaluate the Safety, Reactogenicity and Immunogenicity of Vaccine CVnCoV in Healthy Adults [https://clinicaltrials.gov/ct2/show/NCT04449276]

48. NCT04450004: Safety, Tolerability and Immunogenicinity of a Coronavirus-Like Particle COVID-19 Vaccine in Adults Aged 18-55 Years [https://clinicaltrials.gov/ct2/show/NCT04450004]

49. NCT04453852: Monovalent Recombinant COVID19 Vaccine (COVAX19) [https://clinicaltrials.gov/ct2/show/NCT04453852]

50. NCT04463472: Study of COVID-19 DNA Vaccine (AG0301-COVID19) [https://clinicaltrials.gov/ct2/show/NCT04463472]

51. NCT04471519: Whole-Virion Inactivated SARS-CoV-2 Vaccine (BBV152) for COVID-19 in Healthy Volunteers (BBV152) [https://clinicaltrials.gov/ct2/show/NCT04471519]

52. NCT04473690: KBP-201 COVID-19 Vaccine Trial in Healthy Volunteers [https://clinicaltrials.gov/ct2/show/NCT04473690]

53. NCT04480957: Ascending Dose Study of Investigational SARS-CoV-2 Vaccine ARCT-021 in Healthy Adult Subjects [https://clinicaltrials.gov/ct2/show/NCT04480957]

54. NCT04487210: A Phase I, Prospective, Open-Labeled Study to Evaluate the Safety and Immunogenicity of MVC-COV1901 [https://clinicaltrials.gov/ct2/show/NCT04487210]

55. NCT04497298: Clinical Trial to Evaluate the Safety and Immunogenicitiy of the COVID-19 Vaccine (COVID-19-101) [https://clinicaltrials.gov/ct2/show/NCT04497298]

56. NCT04505722: Ad26COVS1 clinical trial [https://clinicaltrials.gov/ct2/show/NCT04505722]

57. NCT04528641: GRAd-COV2 Vaccine Against COVID-19 [https://www.clinicaltrials.gov/ct2/show/NCT04528641?term=GRAd-COV2&draw=2&rank=1]

58. NCT04591184: A Clinical Trial of a Plasmid DNA Vaccine for COVID-19 [Covigenix VAX-001] in Adults [https://clinicaltrials.gov/ct2/show/NCT04591184]

59. NCT04655625: Clinical trial for vaccine AG0302-COVID19 [https://clinicaltrials.gov/ct2/show/NCT04655625]

60. NCT04751682: Safety and Immunogenicity of an Intranasal SARS-CoV-2 Vaccine (BBV154) for COVID-19 [https://clinicaltrials.gov/ct2/show/NCT04751682]

61. NCT04773665: Safety, Tolerability, and Immunogenicity of the COVID-19 Vaccine Candidate (VBI-2902a) [https://clinicaltrials.gov/ct2/show/NCT04773665]

62. NCT04798001: Safety and Immunogenicity of an Intranasal RSV Vaccine Expressing SARS-CoV-2 Spike Protein (COVID-19 Vaccine) in Adults [https://clinicaltrials.gov/ct2/show/NCT04798001?term=covid-19+vaccine&draw=2]

63. NCT05047445 - COVIDITY: A First Time in Human Phase 1 Open-Label Study of the COVIDITY Vaccine Administered by Needle-free Injection [https://clinicaltrials.gov/ct2/show/NCT05047445]

64. NCT05125926: A Phase Ⅰ Trial to Evaluate the Safety and Immunogenicity of SARS-CoV-2 Vaccine LYB001 [https://clinicaltrials.gov/ct2/show/NCT05125926]

65. Polack et al., 2020: Polack FP, Thomas SJ, Kitchin N, Absalon J, Gurtman A, Lockhart S, Perez JL, Pérez Marc G, Moreira ED, Zerbini C, Bailey R, Swanson KA, Roychoudhury S, Koury K, Li P, Kalina WV, Cooper D, Frenck RW Jr, Hammitt LL, Türeci Ö, Nell H, Schaefer A, Ünal S, Tresnan DB, Mather S, Dormitzer PR, Şahin U, Jansen KU, Gruber WC. Safety and Efficacy of the BNT162b2 mRNA Covid-19 Vaccine. The New England journal of medicine. 2020; 383(27); 2603-2615. [PubMed: 33301246].

66. Richmond et al., 2021: Peter Richmond 1, Lara Hatchuel 2, Min Dong 3, Brenda Ma 3, Branda Hu 3, Igor Smolenov 3, Ping Li 3, Peng Liang 3, Htay Htay Han 3, Joshua Liang 3, Ralf Clemens 4. Safety and immunogenicity of S-Trimer (SCB-2019), a protein subunit vaccine candidate for COVID-19 in healthy adults: a phase 1, randomised, double-blind, placebo-controlled trial. . 2021; ; . [PubMed: 33524311].

67. Saha et al., 2020: Saha RP, Sharma AR, Singh MK, Samanta S, Bhakta S, Mandal S, Bhattacharya M, Lee SS, Chakraborty C. Repurposing Drugs, Ongoing Vaccine, and New Therapeutic Development Initiatives Against COVID-19. Frontiers in pharmacology. 2020; 11; 1258. [PubMed: 32973505].

68. Sahin et al., 2020: BNT162b2 induces SARS-CoV-2-neutralising antibodies and T cells in humans [https://www.medrxiv.org/content/10.1101/2020.12.09.20245175v1.full?fbclid=IwAR2Drk0yoZUvLdve1MCKeMXm4s7lVqUD2BmPnJ07Og7eE3rOQgWDdwwAEdA]

69. Smith et al., 2020: Smith TRF, Patel A, Ramos S, Elwood D, Zhu X, Yan J, Gary EN, Walker SN, Schultheis K, Purwar M, Xu Z, Walters J, Bhojnagarwala P, Yang M, Chokkalingam N, Pezzoli P, Parzych E, Reuschel EL, Doan A, Tursi N, Vasquez M, Choi J, Tello-Ruiz E, Maricic I, Bah MA, Wu Y, Amante D, Park DH, Dia Y, Ali AR, Zaidi FI, Generotti A, Kim KY, Herring TA, Reeder S, Andrade VM, Buttigieg K, Zhao G, Wu JM, Li D, Bao L, Liu J, Deng W, Qin C, Brown AS, Khoshnejad M, Wang N, Chu J, Wrapp D, McLellan JS, Muthumani K, Wang B, Carroll MW, Kim JJ, Boyer J, Kulp DW, Humeau LMPF, Weiner DB, Broderick KE. Immunogenicity of a DNA vaccine candidate for COVID-19. Nature communications. 2020; 11(1); 2601. [PubMed: 32433465].

70. Spencer et. al 2022 [PubMed ID: 35228013]: Alexandra J Spencer,, Susan Morris , Marta Ulaszewska , Claire Powers , Reshma Kailath , Cameron Bissett, Adam Truby, Nazia Thakur, Joseph Newman, Elizabeth R Allen , Indra Rudiansyah, Chang Liu, Wanwisa Dejnirattisai, Juthathip Mongkolsapaya, Hannah Davies, Francesca R Donnellan, David Pulido, Thomas P Peacock, Wendy S Barclay, Helen Bright, Kuishu Ren, Gavin Screaton, Patrick McTamney, Dalan Bailey, Sarah C Gilbert, Teresa Lambe. The ChAdOx1 vectored vaccine, AZD2816, induces strong immunogenicity against SARS-CoV-2 beta (B.1.351) and other variants of concern in preclinical studies. . 2022; ; . [PubMed: 35228013].

71. Sun et al., 2020: Sun W, Leist SR, McCroskery S, Liu Y, Slamanig S, Oliva J, Amanat F, Schäfer A, Dinnon KH 3rd, García-Sastre A, Krammer F, Baric RS, Palese P. Newcastle disease virus (NDV) expressing the spike protein of SARS-CoV-2 as a live virus vaccine candidate. EBioMedicine. 2020; 62; 103132. [PubMed: 33232870].

72. Tebas et al., 2020: Tebas P, Yang S, Boyer JD, Reuschel EL, Patel A, Christensen-Quick A, Andrade VM, Morrow MP, Kraynyak K, Agnes J, Purwar M, Sylvester A, Gillespie E, Maricic I, Zaidi FI, Kim KY, Dia Y, Frase D, Pezzoli P, Schultheis K, Smith TRF, Ramos SJ, McMullan T, Buttigieg K, Carroll MW, Ervin J, Diehl MC, Blackwood E, Mammen MP, Lee J, Dallas MJ, Brown AS, Shea JE, Kim JJ, Weiner DB, Broderick KE, Humeau LM. Safety and immunogenicity of INO-4800 DNA vaccine against SARS-CoV-2: A preliminary report of an open-label, Phase 1 clinical trial. EClinicalMedicine. 2020; ; 100689. [PubMed: 33392485].

73. Thiagarajan, 2021: What do we know about India’s Covaxin vaccine? [https://www.bmj.com/content/373/bmj.n997]

74. Tian et al., 2021: Tian JH, Patel N, Haupt R, Zhou H, Weston S, Hammond H, Logue J, Portnoff AD, Norton J, Guebre-Xabier M, Zhou B, Jacobson K, Maciejewski S, Khatoon R, Wisniewska M, Moffitt W, Kluepfel-Stahl S, Ekechukwu B, Papin J, Boddapati S, Jason Wong C, Piedra PA, Frieman MB, Massare MJ, Fries L, Bengtsson KL, Stertman L, Ellingsworth L, Glenn G, Smith G. SARS-CoV-2 spike glycoprotein vaccine candidate NVX-CoV2373 immunogenicity in baboons and protection in mice. Nature communications. 2021; 12(1); 372. [PubMed: 33446655].

75. Tran et. al 2021: Thi Nhu Mai Tran, Bruce Pearson May, Trong Thuan Ung, Mai Khoi Nguyen, Thi Thuy Trang Nguyen, Van Long Dinh, Chinh Chung Doan 1, The Vinh Tran 1, Hiep Khong 1, Thi Thanh Truc Nguyen 1, Hoang Quoc Huy Hua 1, Viet Anh Nguyen 1, Tan Phat Ha 1, Dang Luu Phan 1, Truong An Nguyen 1, Thi Ngoc Bui 1, Tieu My Tu 1, Thi Theo Nguyen 1, Thi Thuy Hang Le 1, Thi Lan Dong 1, Trong Hieu Huynh 1, Phien Huong Ho 1, Nguyen Thanh Thao Le 1, Cong Thao Truong 1, Hoang Phi Pham 1, Cong Y Luong 1, Nie Lim Y 1, Minh Ngoc Cao 1, Duy Khanh Nguyen 1, Thi Thanh Le 2, Duc Cuong Vuong 2, Le Khanh Hang Nguyen 2, Minh Si Do 1. Preclinical Immune Response and Safety Evaluation of the Protein Subunit Vaccine Nanocovax for COVID-19. . 2021; ; . [PubMed: 34938290].

76. van et al., 2020: van Doremalen N, Lambe T, Spencer A, Belij-Rammerstorfer S, Purushotham JN, Port JR, Avanzato VA, Bushmaker T, Flaxman A, Ulaszewska M, Feldmann F, Allen ER, Sharpe H, Schulz J, Holbrook M, Okumura A, Meade-White K, Pérez-Pérez L, Edwards NJ, Wright D, Bissett C, Gilbride C, Williamson BN, Rosenke R, Long D, Ishwarbhai A, Kailath R, Rose L, Morris S, Powers C, Lovaglio J, Hanley PW, Scott D, Saturday G, de Wit E, Gilbert SC, Munster VJ. ChAdOx1 nCoV-19 vaccine prevents SARS-CoV-2 pneumonia in rhesus macaques. Nature. 2020; 586(7830); 578-582. [PubMed: 32731258].

77. Vogel et al., 2020: A prefusion SARS-CoV-2 spike RNA vaccine is highly immunogenic and prevents lung infection in non-human primates [https://www.biorxiv.org/content/10.1101/2020.09.08.280818v1.full?fbclid=IwAR1hGehYH9pEO70RRGT56XB_aJ2O5NFux9YN6XBzmCkXzNsjREuo11q5ub4]

78. Walsh et al., 2020: Walsh EE, Frenck R, Falsey AR, Kitchin N, Absalon J, Gurtman A, Lockhart S, Neuzil K, Mulligan MJ, Bailey R, Swanson KA, Li P, Koury K, Kalina W, Cooper D, Fontes-Garfias C, Shi PY, Türeci Ö, Thompkins KR, Lyke KE, Raabe V, Dormitzer PR, Jansen KU, Sahin U, Gruber WC. RNA-Based COVID-19 Vaccine BNT162b2 Selected for a Pivotal Efficacy Study. medRxiv : the preprint server for health sciences. 2020; ; . [PubMed: 32839784].

79. Walsh et al., 2020: Walsh EE, Frenck RW Jr, Falsey AR, Kitchin N, Absalon J, Gurtman A, Lockhart S, Neuzil K, Mulligan MJ, Bailey R, Swanson KA, Li P, Koury K, Kalina W, Cooper D, Fontes-Garfias C, Shi PY, Türeci Ö, Tompkins KR, Lyke KE, Raabe V, Dormitzer PR, Jansen KU, Şahin U, Gruber WC. Safety and Immunogenicity of Two RNA-Based Covid-19 Vaccine Candidates. The New England journal of medicine. 2020; 383(25); 2439-2450. [PubMed: 33053279].

80. Wang et al. 2022: Xuan-Yi Wang 1 2 3, Syed Faisal Mahmood 4, Fang Jin 5 6, Wee Kooi Cheah 7, Muhammad Ahmad 8, Mian Amjad Sohail 9, Waheed Ahmad 10, Vijaya K Suppan 11, Muneeba Ahsan Sayeed 12, Shobha Luxmi 13, Aik-Howe Teo 14, Li Yuan Lee 15, Yang-Yang Qi 1 2, Rong-Juan Pei 16, Wei Deng 6, Zhong-Hui Xu 17, Jia-Ming Yang 17, Yan Zhang 17, Wu-Xiang Guan 16, Xiong Yu 18. Efficacy of heterologous boosting against SARS-CoV-2 using a recombinant interferon-armed fusion protein vaccine (V-01): a randomized, double-blind and placebo-controlled phase III trial. . 2022; ; . [PubMed: 35686572].

81. Wang et al., 2020: Wang F, Kream RM, Stefano GB. An Evidence Based Perspective on mRNA-SARS-CoV-2 Vaccine Development. Medical science monitor : international medical journal of experimental and clinical research. 2020; 26; e924700. [PubMed: 32366816].

82. Wang et al., 2020: Wang H, Zhang Y, Huang B, Deng W, Quan Y, Wang W, Xu W, Zhao Y, Li N, Zhang J, Liang H, Bao L, Xu Y, Ding L, Zhou W, Gao H, Liu J, Niu P, Zhao L, Zhen W, Fu H, Yu S, Zhang Z, Xu G, Li C, Lou Z, Xu M, Qin C, Wu G, Gao GF, Tan W, Yang X. Development of an Inactivated Vaccine Candidate, BBIBP-CorV, with Potent Protection against SARS-CoV-2. Cell. 2020; 182(3); 713-721.e9. [PubMed: 32778225].

83. Wuertz et al., 2021: . A SARS-CoV-2 spike ferritin nanoparticle vaccine protects hamsters against Alpha and Beta virus variant challenge. . ; ; . [PubMed: 34711815].

84. Xia et al., 2020: Xia S, Duan K, Zhang Y, Zhao D, Zhang H, Xie Z, Li X, Peng C, Zhang Y, Zhang W, Yang Y, Chen W, Gao X, You W, Wang X, Wang Z, Shi Z, Wang Y, Yang X, Zhang L, Huang L, Wang Q, Lu J, Yang Y, Guo J, Zhou W, Wan X, Wu C, Wang W, Huang S, Du J, Meng Z, Pan A, Yuan Z, Shen S, Guo W, Yang X. Effect of an Inactivated Vaccine Against SARS-CoV-2 on Safety and Immunogenicity Outcomes: Interim Analysis of 2 Randomized Clinical Trials. JAMA. 2020; ; . [PubMed: 32789505].

85. Xu et al., 2023: Ke Xu 1, Wenwen Lei 1, Bin Kang 2 3, Hanyu Yang 2 3, Yajuan Wang 2 3, Yanli Lu 2 3, Lu Lv 2 3, Yufei Sun 2 3, Jing Zhang 1, Xiaolin Wang 2 3, Mengjie Yang 1, Mo Dan 2 3, Guizhen Wu 1. A novel mRNA vaccine, SYS6006, against SARS-CoV-2. . ; ; . [PubMed: 36685587].

86. Ying et al., 2022: Baoling Ying 1, Suzanne M Scheaffer 1, Bradley Whitener 1, Chieh-Yu Liang 2, Oleksandr Dmytrenko 1, Samantha Mackin 2, Kai Wu 3, Diana Lee 3, Laura E Avena 3, Zhenlu Chong 1, James Brett Case 1, LingZhi Ma 3, Thu T M Kim 3, Caralyn E Sein 3, Angela Woods 3, Daniela Montes Berrueta 3, Gwo-Yu Chang 3, Guillaume Stewart-Jones 3, Isabella Renzi 3, Yen-Ting Lai 3, Agata Malinowski 3, Andrea Carfi 3, Sayda M Elbashir 3, Darin K Edwards 3, Larissa B Thackray 4, Michael S Diamond 5. Boosting with variant-matched or historical mRNA vaccines protects against Omicron infection in mice. . ; ; . [PubMed: 35452622].

87. Zha, et al., 2020: Lisha Zha, Hongxin Zhao, Mona O. Mohsen, Liang Hong, Yuhang Zhou, Chuankai Yao, Lijie Guo, Zehua Li, Hongquan Chen, Xuelan Liu, Xinyue Chang, Jie Zhang, Dong Li, Ke Wu, Monique Vogel, Martin F Bachmann, Junfeng Wang. Development of a COVID-19 vaccine based on the receptor binding domain displayed on virus-like particles. . ; ; .

88. Zhang et al., 2020: Zhang NN, Li XF, Deng YQ, Zhao H, Huang YJ, Yang G, Huang WJ, Gao P, Zhou C, Zhang RR, Guo Y, Sun SH, Fan H, Zu SL, Chen Q, He Q, Cao TS, Huang XY, Qiu HY, Nie JH, Jiang Y, Yan HY, Ye Q, Zhong X, Xue XL, Zha ZY, Zhou D, Yang X, Wang YC, Ying B, Qin CF. A Thermostable mRNA Vaccine against COVID-19. Cell. 2020; 182(5); 1271-1283.e16. [PubMed: 32795413].

89. Zhang et al., 2020: Zhang Y, Zeng G, Pan H, Li C, Hu Y, Chu K, Han W, Chen Z, Tang R, Yin W, Chen X, Hu Y, Liu X, Jiang C, Li J, Yang M, Song Y, Wang X, Gao Q, Zhu F. Safety, tolerability, and immunogenicity of an inactivated SARS-CoV-2 vaccine in healthy adults aged 18-59 years: a randomised, double-blind, placebo-controlled, phase 1/2 clinical trial. The Lancet. Infectious diseases. 2020; ; . [PubMed: 33217362].

90. Zhang et al., 2022: Zhiren Zhang 1, Qiaren He 2, Wei Zhao 1, Yong Li 1, Jiaming Yang 3, Zhenxiang Hu 3, Xi Chen 3, Hua Peng 4, Yang-Xin Fu 5, Long Chen 2, Ligong Lu 1. A Heterologous V-01 or Variant-Matched Bivalent V-01D-351 Booster following Primary Series of Inactivated Vaccine Enhances the Neutralizing Capacity against SARS-CoV-2 Delta and Omicron Strains. . ; ; . [PubMed: 35887928].

91. Zhang et. al: Zheng M, Wang P, Song W, Lau SY, Liu S, Huang X, Mok BW, Liu YC, Chen Y, Yuen KY, Chen H. An. A14U Substitution in the 3' Noncoding Region of the M Segment of Viral RNA Supports Replication of Influenza Virus with an NS1 Deletion by Modulating Alternative Splicing of M Segment mRNAs. . 2015; ; . [PubMed: 26223635].

92. Zhu et al., 2020: Zhu FC, Li YH, Guan XH, Hou LH, Wang WJ, Li JX, Wu SP, Wang BS, Wang Z, Wang L, Jia SY, Jiang HD, Wang L, Jiang T, Hu Y, Gou JB, Xu SB, Xu JJ, Wang XW, Wang W, Chen W. Safety, tolerability, and immunogenicity of a recombinant adenovirus type-5 vectored COVID-19 vaccine: a dose-escalation, open-label, non-randomised, first-in-human trial. Lancet (London, England). 2020; 395(10240); 1845-1854. [PubMed: 32450106].