VIOLIN: Vaccine Investigation and Online Information Network

Eimeria acervulina

Table of Contents

General Information
1. NCBI Taxonomy ID
Vaccine Related Pathogen Genes
1. hypothetical protein (Protective antigen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

5801

II. Vaccine Related Pathogen Genes

1. hypothetical protein

Gene Name : hypothetical protein
Sequence Strain (Species/Organism) : Eimeria acervulina
NCBI Protein GI : AFB77195
Taxonomy ID : 5801
Protein Name : hypothetical protein
Protein pI : 8.68
Protein Weight : 5170.54
Protein Length : 106

Protein Sequence : Show Sequence

>AFB77195.1 hypothetical protein [Eimeria acervulina]
MCSLNDLGSSTQFAAIRQCVVLRKAYTAVVHRTSTASVGPCMKMCPSLGQ

Molecule Role : Protective antigen
Molecule Role Annotation : (Zhu et al., 2012)

III. Vaccine Information

IV. References

1. Zhu et al., 2012: Zhu H, Xu L, Yan R, Song X, Tang F, Wang S, Li X. Identification and characterization of a cDNA clone-encoding antigen of Eimeria acervulina. Parasitology. 2012; 139(13); 1711-1719. [PubMed: 23036233].