VIOLIN: Vaccine Investigation and Online Information Network

Pathogen Page

Rickettsia rickettsii

Table of Contents

General Information
1. NCBI Taxonomy ID
Vaccine Related Pathogen Genes
1. ygbF (Protective antigen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

783

II. Vaccine Related Pathogen Genes

1. ygbF

Gene Name : ygbF
Sequence Strain (Species/Organism) : Rickettsia rickettsii
NCBI Protein GI : WP_012150526
Other Database IDs : CDD:224643
CDD:276809
Taxonomy ID : 783
Gene Strand (Orientation) : ?
Protein Name : tol-pal system protein YbgF
Protein pI : 9.32
Protein Weight : 27854.92
Protein Length : 318
Protein Note : Periplasmic TolA-binding protein (function unknown) [General function prediction only]; COG1729

Protein Sequence : Show Sequence

>WP_012150526.1 tol-pal system protein YbgF [Rickettsia rickettsii]
MKLIVLLFTFLFSMFSFGESETIKGKPLKYVANNDFENRLDEQEQEIRRLIGKVEVLQHKIDLLTQNSNI
SNQEENTEVLEAGDSKKQDVFDIALLKDMTDNAPKKPITVNKDIAPDKQAYDLALAAYKDNKLTEAKDKF
KNFIQKYPNSLLISNAYFWYGECFFKQKDYNGAAVNYLKGYKELPKGAKSSDGLLKLALSLGELKKTQEA
CNMLAKFDKEFPTNRTAASKKMAEDAKIKFGCKNK

Molecule Role : Protective antigen
Molecule Role Annotation : (Gong et al., 2015)

III. Vaccine Information

IV. References

1. Gong et al., 2015: Gong W, Wang P, Xiong X, Jiao J, Yang X, Wen B. Chloroform-Methanol Residue of Coxiella burnetii Markedly Potentiated the Specific Immunoprotection Elicited by a Recombinant Protein Fragment rOmpB-4 Derived from Outer Membrane Protein B of Rickettsia rickettsii in C3H/HeN Mice. PloS one. 2015; 10(4); e0124664. [PubMed: 25909586].