|
|
Mycobacterium bovis |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Vaccine Related Pathogen Genes
- 85-B
(Protective antigen)
- Vaccine Information
- Bacillus Calmette-Guérin Danish (BCG)
- M. bovis DNA vaccine pCI-Ag85B
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
1765 |
|
2. Disease: |
| Tuberculosis |
| II. Vaccine Related Pathogen Genes |
|
1. 85-B |
-
Gene Name :
85-B
-
Sequence Strain (Species/Organism) :
Mycobacterium bovis strain 1173P2
-
NCBI Protein GI :
44168
-
Other Database IDs :
CDD:223700
GOA:A1KJU9
InterPro: IPR000801
UniProtKB/UniProt: A1KJU9
-
Taxonomy ID :
1765
-
Gene Strand (Orientation) :
?
-
Protein Name :
protein or antigen 85-B
-
Protein pI :
5.72
-
Protein Weight :
33433.87
-
Protein Length :
410
-
Protein Note :
S-formylglutathione hydrolase FrmB [Defense mechanisms]; COG0627
-
Protein Sequence : Show Sequence
>CAA44268.1 protein or antigen 85-B [Mycobacterium tuberculosis variant bovis]
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG
NNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETL
LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGD
AGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF
QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
M. bovis DNA vaccine pCI-Ag85B
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. Bacillus Calmette-Guérin Danish (BCG) |
| a. Vaccine Ontology ID: |
| VO_0004807 |
| b. Type: |
| Live, attenuated vaccine |
| c. Status: |
| Licensed |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Immunization Route |
| subcutaneous injection |
| f.
Cattle Response |
- Vaccination Protocol:
Two groups of calves (n = 9/group) were vaccinated subcutaneously with a lyophilized BCG Danish vaccine containing either 0.5 (1 × 105 to 4 × 105 CFU) or 5 (1 × 106 to 4 × 106 CFU) human doses of BCG Danish, with an additional group of 10 calves serving as non vaccinated controls (Buddle et al., 2013).
- Challenge Protocol:
Intratracheal challenge with 5 × 103 CFU of virulent M. bovis 15 weeks after vaccination (Buddle et al., 2013).
- Efficacy:
Vaccination of the calves with either 0.5 or 5 equivalent human doses of BCG Danish induced similar levels of protection against challenge with M. bovis, with both groups showing significant reductions in the pathological and microbiological parameters compared to those for the the control group (P < 0.05) (Buddle et al., 2013).
|
|
|
|
 |
|
 |
|
|
|
|
|
|
|
|
|
2. M. bovis DNA vaccine pCI-Ag85B |
| a. Vaccine Ontology ID: |
| VO_0004806 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Host Species as Laboratory Animal Model: |
| Mouse |
| f. Gene Engineering of
85-B |
|
| g. Vector: |
| pCI (Teixeira et al., 2006) |
| h. Immunization Route |
| Intramuscular injection (i.m.) |
| i.
Mouse Response |
- Efficacy:
Ag85B DNA immunization induced a statistically significant reduction in M. bovis CFU numbers in spleens (log 0.56) compared to what was seen for mice that received the plasmid pCI alone (P < 0.05). However, there was no significant reduction in bacterial load in lungs of pCI-Ag85B-immunized mice compared to the pCI control group (Teixeira et al., 2006).
|
|
|
|
|
|
|
|
|
| IV. References |
1. Buddle et al., 2013: Buddle BM, Hewinson RG, Vordermeier HM, Wedlock DN. Subcutaneous administration of a 10-fold-lower dose of a commercial human tuberculosis vaccine, Mycobacterium bovis bacillus Calmette-Guerin Danish, induced levels of protection against bovine tuberculosis and responses in the tuberculin intradermal test similar to those induced by a standard cattle dose. Clinical and vaccine immunology : CVI. 2013; 20(10); 1559-1562. [PubMed: 23925885].
2. Teixeira et al., 2006: Teixeira FM, Teixeira HC, Ferreira AP, Rodrigues MF, Azevedo V, Macedo GC, Oliveira SC. DNA vaccine using Mycobacterium bovis Ag85B antigen induces partial protection against experimental infection in BALB/c mice. Clinical and vaccine immunology : CVI. 2006; 13(8); 930-935. [PubMed: 16893994].
|
|
