VIOLIN: Vaccine Investigation and Online Information Network

Pathogen Page

Mycobacterium marinum

Table of Contents

General Information
1. NCBI Taxonomy ID
2. Introduction
Vaccine Related Pathogen Genes
1. fbpA (Protective antigen)
Vaccine Information
1. M. marinum pCMV-85A
References

I. General Information

1. NCBI Taxonomy ID:

1781

2. Introduction

Mycobacterium marinum is an atypical Mycobacterium species found in cold or warm, fresh or salted water. M marinum infection occurs following skin and soft-tissue injuries that are exposed to an aquatic environment or marine animals. The infection usually presents as a localized granuloma but can evolve into an ascending lymphangitis that resembles sporotrichosis or can spread to deeper tissues. M marinum is a pathogen classified in Runyon group 1 and is a photochromogen, meaning it produces pigment when cultured and exposed to light. Culture growth occurs over 7-14 days and is optimal at 32°C (Medscape - Mycobacterium marinum).

II. Vaccine Related Pathogen Genes

1. fbpA

Gene Name : fbpA
Sequence Strain (Species/Organism) : Mycobacterium marinum
NCBI Protein GI : 13431282
Other Database IDs : CDD:304388
Taxonomy ID : 1781
Gene Strand (Orientation) : ?
Protein Name : Diacylglycerol acyltransferase/mycolyltransferase Ag85A
Protein pI : 7.43
Protein Weight : 18276.89
Protein Length : 422
Protein Note : DGAT; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; Fibronectin-binding protein A; 85A; Ag85A; Fbps A

Protein Sequence : Show Sequence

>sp|Q9KH57.1|A85A_MYCMR RecName: Full=Diacylglycerol acyltransferase/mycolyltransferase Ag85A; Short=DGAT; AltName: Full=Acyl-CoA:diacylglycerol acyltransferase; AltName: Full=Antigen 85 complex A; Short=85A; Short=Ag85A; AltName: Full=Fibronectin-binding protein A; Short=Fbps A
PTGSGVVGLSMAGSSALILAAYHPDQFVYSGSLSALLDPSQGMGPSLIGLAMGDAGGYKASDMWGPKDDP
AWARNDPMLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNMKFQAAYNAAGGHNAVWN

Molecule Role : Protective antigen
Related Vaccine(s): M. marinum pCMV-85A

III. Vaccine Information

1. M. marinum pCMV-85A

a. Vaccine Ontology ID:

VO_0004496

b. Type:

DNA vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Fish

e. Gene Engineering of fbpA

Type: DNA vaccine construction
Description: Vector pcDNA 3.1 expressed Mycobacterium marinum Ag85A gene (Pasnik and Smith, 2005).
Detailed Gene Information: Click here.

f. Vector:

pcDNA 3.1 (Pasnik and Smith, 2005)

g. Immunization Route

Intraperitoneal injection (i.p.)

h. Fish Response

Vaccine Immune Response Type: VO_0000286
Efficacy: Fish receiving the DNA vaccine developed a protective response to a live M. marinum challenge 90 days post-inoculation, as demonstrated by increased survival of vaccinated fish over control fish and by reduced splenic bacterial counts in vaccinated fish (Pasnik and Smith, 2005).

IV. References

1. Medscape - Mycobacterium marinum: Mycobacterium Marinum [http://emedicine.medscape.com/article/223363-overview]

2. Pasnik and Smith, 2005: Pasnik DJ, Smith SA. Immunogenic and protective effects of a DNA vaccine for Mycobacterium marinum in fish. Veterinary immunology and immunopathology. 2005; 103(3-4); 195-206. [PubMed: 15621306].