|
Sindbis virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- E2
(Protective antigen)
- Vaccine Information
- Sindbis virus DNA vaccine encoding E2
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11034 |
2. Disease: |
Encephalitis |
3. Introduction |
Sindbis Virus (SINV) is a member of the Togaviridae family, in the alphavirus subfamily. The virus is transmitted by mosquitoes. Sindbis fever is most common in South and East Africa, Egypt, Israel, Philippines and parts of Australia. Sindbis virus is an "arbovirus" (arthropod-borne) and is maintained in nature by transmission between vertebrate (bird) hosts and invertebrate (mosquito) vectors. Sindbis viruses are enveloped particles with an icosahedral capsid. Its genome is a single stranded RNA approximately 11.7kb long. It has a 5' cap and 3' polyadenylated tail therefore serves directly as messenger RNA (mRNA) in a host cell. The genome encodes four non-structural proteins at the 5' end and the capsid and two envelope proteins at the 3' end. Replication is cytoplasmic and rapid. The genomic RNA is partially translated at the 5’ end to produce the non-structural proteins which are then involved in genome replication and the production of new genomic RNA and a shorter sub-genomic RNA strand. This sub-genomic strand is translated into the structural proteins. The viruses assemble at the host cell surfaces and acquire their envelope through budding. A non-coding RNA element has been found to be essential for Sindbis virus genome replication (Wikipedia - Sindbis virus). |
II. Vaccine Related Pathogen Genes |
1. E2 |
-
Gene Name :
E2
-
Sequence Strain (Species/Organism) :
Sindbis virus
-
NCBI Protein GI :
20257395
-
Other Database IDs :
CDD:279311
-
Taxonomy ID :
11034
-
Gene Strand (Orientation) :
?
-
Protein Name :
polyprotein
-
Protein pI :
8.76
-
Protein Weight :
14816.73
-
Protein Length :
189
-
Protein Note :
Alphavirus E2 glycoprotein; pfam00943
-
Protein Sequence : Show Sequence
>AAM15875.1 polyprotein, partial [Sindbis virus]
KPPSGKNITYECKCGDYKTATVSVRTEIAGCTAIKQCVAYKSDQTKWVFNSPDLIRHADHTAQGKLHLPF
KPTLSTCLVPLAHEPTVTHGFKHISLHLDTDHPTLLTTRRLGEKPEPTSEWISGKTVRNFTVDRDGL
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Sindbis virus DNA vaccine encoding E2
|
III. Vaccine Information |
|
|
|
|
|
|
1. Sindbis virus DNA vaccine encoding E2 |
a. Vaccine Ontology ID: |
VO_0004491 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Mouse |
e. Gene Engineering of
E2 |
- Type:
DNA vaccine construction
- Description:
Vector pCI-neo expressed the SV E2 gene with an upstream Kozak sequence and a downstream FLAG tag (Zanin et al., 2007).
- Detailed Gene Information: Click here.
|
f. Vector: |
pCI-neo vector (Promega) (Zanin et al., 2007) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Mouse Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
This vaccination strategy was immunogenic and provided partial protection against viral encephalitis in a murine model (Zanin et al., 2007).
|
|
|
|
|
|
|
|
|
IV. References |
1. Wikipedia - Sindbis virus: Sindbis virus [http://en.wikipedia.org/wiki/Sindbis_virus]
|
|