E. tarda is typically found in the normal gut flora of fish and humans, and can be an opportunistic pathogen in human, causing gastroenteritis and diarrhea. E. tarda has a high affinity for red blood cells due to specific fimbriae that it produces (Microbe Wiki: E. tarda).
Molecule Role Annotation :
An aroC mutant is attenuated in zebra fish. The aroC mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 68.3% (Xiao et al., 2011).
Molecule Role Annotation :
Together these results indicate that Esa1 is a protective immunogen and an effective oral vaccine when delivered by FP3/pJsa1 as a surface-anchored antigen.(Sun et al., 2010)
Molecule Role Annotation :
An esrB mutant is highly attenuated in fish (turbot), with an LD50 of 10(8.1)cfu/fish. Vaccination with this mutant elicited significant protection from wild type E. tarda (Lan et al., 2007).
Molecule Role Annotation :
An aroC and esrC mutant is attenuated in zebra fish. This mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 71.3% (Xiao et al., 2011).
>BAE44431.1 antigenic protein Et 18 [Edwardsiella tarda]
MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRSVGTQVDDGTLEARISNALSKDAQLK
KEARVVVTAYQGQVLLTGQAPSQALISRAKQIAMGVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQ
LLASDQVKSTNVKVTTENGEVFLLGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK
>ABK57121.1 major fimbrial subunit protein [Edwardsiella tarda]
MKKILLPVMALSASVMSGQVSAANGTVNFTGEIINSTCQVSGDSKNIDVYLGKYPTSAFKAIGDKSASKA
FQINLEQCEPGTYTVRFDGNTVAGHPDLLAVSGDGSTAAAQGLGIEITDINGKHFAIANKATGEEPTVKV
VGDKKAVFNLQARYRSYADTVTAGLANATSPFTIEYK
Protein Note :
chaperonin_like superfamily. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. There are 2 main chaperonin groups. The symmetry of type I...; cl02777
>ACT33424.1 outer membrane protein A precursor [Edwardsiella tarda]
MKKTAIALAVALAGFATVAQAAPKDDTWYVGGKLGWSHFISNSFEDMGTTKSHPNQLGAGAFFGYQANPY
LGFEMGYDWLGRMGYTGDVNAKFKSQGVQLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSH
DTGVSPLAAIGVEYALNKDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRFGQDEVAAPAPIPAPA
PAPVVETKRFTLKSDVLFNFNKYTLKAEGRQALDQLYSQLSSMDPKDGSVVVLGYTDRIGSDQYNLKLSK
QRAQTVVDYLVSKGIPADKIAARGMGKADPVTGSTCDNVKPRAALINCLAPDRRVVIEVKGIKEEVTQPQ
A
Protein Name :
Outer membrane protein C precursor Porin OmpC
Protein pI :
8.23
Protein Weight :
40772.04
Protein Length :
470
Protein Note :
Porin superfamily. These outer membrane channels share a beta-barrel structure that differ in strand and shear number. Classical (gram-negative) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; cl21487
Molecule Role Annotation :
An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% (Xiao et al., 2011).
Cell-penetrating peptides (CPPs) are short cationic/amphipathic peptides which facilitate cellular uptake of various molecular cargoes and therefore have great potentials in vector vaccine design. Among the tested CPPs, TAT showed an excellent capability to deliver the cargo protein EGFP into cytoplasm (Ma et al., 2014). In order to establish an efficient antigen delivery system in Escherichia coli, the EGFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system, the resultant E. coli was proved to be able to lyse upon the induction of a mimic in vivo signal and thus release intracellular EGFP-TAT intensively, which were assumed to undergo a more efficient intracellular delivery by CPP to evoke protective immune responses. Based on the established antigen delivery system, the protective antigen gene flgD from an invasive intracellular fish pathogen Edwardsiella tarda EIB202, was applied to establish an E. coli recombinant vector vaccine (Ma et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g.
Zebrafish Response
Vaccine Immune Response Type:
VO_0000287
Efficacy:
BL21(DE3)/pUTa-E + pET28a-FT conferred an significantly better immune protection (RPS of 63%) than the other control strains. This result suggested fused cell-penetrating peptides (CPPs) could facilitate the internalization of antigens, released by the lysed bacteria, into the immune-related cells, such as macrophage, and in turn promote a more protective immune response in host (Ma et al., 2014).
GFP-TAT synthesis circuit was combined with an in vivo inducible lysis circuit PviuA-E in E. coli to form an integrated antigen delivery system (Ma et al., 2014).
f. Immunization Route
Intramuscular injection (i.m.)
g.
Fish Response
Vaccine Immune Response Type:
VO_0003057
Challenge Protocol:
Hosts were challenged with E. tarda EIB202 (Ma et al., 2014).
Efficacy:
This E. coli vector vaccine presented superior immune protection under the challenge with E. tarda EIB202, suggesting that the novel antigen delivery system had great potential in bacterial vector vaccine applications (Ma et al., 2014).
Efficacy:
Following TX1 challenge, fish immunized with pCE18, pCN3 (plasmid), and PBS exhibited cumulative mortalities of 35%, 90%, and 95%, respectively. Hence, with pCN3 as a control, the protective efficacy of pCE18 was 61% in terms of RPS (Jiao et al., 2009).
Efficacy:
Upon exposure to TX1 challenge, the cumulative mortalities of the pCE6-, pCN3-, and PBS-vaccinated fish were 25%, 90%, and 95%, respectively. Therefore, compared to vaccination with pCN3, vaccination with pCE6 produced a RPS of 72%, which is significantly higher than that produced by pEta6 (Jiao et al., 2009).
Efficacy:
The accumulated mortalities of pCEsa1-, pCN3-, and PBS-vaccinated fish were 20%, 76%, and 80%, respectively. Hence, compared to PBS-vaccinated fish, pCEsa1-vaccinated fish were significantly (P < 0.05) protected, with a RPS of 75% (Sun et al., 2011).
Persistence:
An aroC mutant is attenuated in zebra fish (Xiao et al., 2011).
Efficacy:
An aroC mutant is protective in zebra fish against challenge from wild type E. tarda, resulting in a 68.3% relative percent survival (Xiao et al., 2011).
7. Edwardsiella tarda aroC/esrC mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Zebra fish
d. Gene Engineering of
aroC
Type:
Gene mutation
Description:
This aroC/esrC mutant is from Edwardsiella tarda (Xiao et al., 2011).
Persistence:
This aroC/esrC mutant is attenuated in zebra fish (Xiao et al., 2011).
Efficacy:
This aroC/esrC mutant is protective against challenge from wild type E. tarda, with a 71.3% relative percent survival (Xiao et al., 2011).
8. Edwardsiella tarda aroC/slyA mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Zebra fish
d. Gene Engineering of
slyA
Type:
Gene mutation
Description:
An aroC and slyA mutant is attenuated in zebra fish. This mutant is also protective against challenge from wild type E. tarda, resulting in a relative percent survival of 80.1% (Xiao et al., 2011).
Persistence:
This aroC/slyA mutant is attenuated in zebra fish (Xiao et al., 2011).
Efficacy:
This aroC/slyA mutant is protective in zebra fish against challenge with wild type E. tarda. The percent relative survival is 80.1% (Xiao et al., 2011).
Persistence:
A esrB mutant is attenuated in fish (Lan et al., 2007).
Efficacy:
An esrB mutant induces significant protection in fish from challenge with wild type Edwardsiella tarda (Lan et al., 2007).
IV. References
1. Beck et al., 2017: Beck BR, Lee SH, Kim D, Park JH, Lee HK, Kwon SS, Lee KH, Lee JI, Song SK. A Lactococcus lactis BFE920 feed vaccine expressing a fusion protein composed of the OmpA and FlgD antigens from Edwardsiella tarda was significantly better at protecting olive flounder (Paralichthys olivaceus) from edwardsiellosis than single antigen vaccines. Fish & shellfish immunology. 2017; 68; 19-28. [PubMed: 28687358].
2. Hu et al., 2012: Hu YH, Dang W, Deng T, Sun L. Edwardsiella tarda DnaK: expression, activity, and the basis for the construction of a bivalent live vaccine against E. tarda and Streptococcus iniae. Fish & shellfish immunology. 2012; 32(4); 616-620. [PubMed: 22281608].
3. Jiao et al., 2009: Jiao XD, Zhang M, Hu YH, Sun L. Construction and evaluation of DNA vaccines encoding Edwardsiella tarda antigens. Vaccine. 2009; 27(38); 5195-5202. [PubMed: 19596416].
4. Jiao et al., 2009: Jiao XD, Dang W, Hu YH, Sun L. Identification and immunoprotective analysis of an in vivo-induced Edwardsiella tarda antigen. Fish & shellfish immunology. 2009; 27(5); 633-638. [PubMed: 19706328].
5. Jiao et al., 2010: Jiao XD, Zhang M, Cheng S, Sun L. Analysis of Edwardsiella tarda DegP, a serine protease and a protective immunogen. Fish & shellfish immunology. 2010; 28(4); 672-677. [PubMed: 20060910].
6. Jiao et al., 2010: Jiao XD, Hu YH, Sun L. Dissection and localization of the immunostimulating domain of Edwardsiella tarda FliC. Vaccine. 2010; 28(34); 5635-5640. [PubMed: 20580470].
7. Jin et al., 2012: Jin RP, Hu YH, Sun BG, Zhang XH, Sun L. Edwardsiella tarda sialidase: pathogenicity involvement and vaccine potential. Fish & shellfish immunology. 2012; 33(3); 514-521. [PubMed: 22705341].
8. Lan et al., 2007: Lan MZ, Peng X, Xiang MY, Xia ZY, Bo W, Jie L, Li XY, Jun ZP. Construction and characterization of a live, attenuated esrB mutant of Edwardsiella tarda and its potential as a vaccine against the haemorrhagic septicaemia in turbot, Scophthamus maximus (L.). Fish & shellfish immunology. 2007; 23(3); 521-530. [PubMed: 17478097].
9. Li et al., 2012: Li MF, Hu YH, Zheng WJ, Sun BG, Wang CL, Sun L. Inv1: an Edwardsiella tarda invasin and a protective immunogen that is required for host infection. Fish & shellfish immunology. 2012; 32(4); 586-592. [PubMed: 22289712].
10. Liu et al., 2016: Liu F, Tang X, Sheng X, Xing J, Zhan W. DNA vaccine encoding molecular chaperone GroEL of Edwardsiella tarda confers protective efficacy against edwardsiellosis. Molecular immunology. 2016; 79; 55-65. [PubMed: 27701022].
11. Liu et al., 2017: Liu F, Tang X, Sheng X, Xing J, Zhan W. Comparative study of the vaccine potential of six outer membrane proteins of Edwardsiella tarda and the immune responses of flounder (Paralichthys olivaceus) after vaccination. Veterinary immunology and immunopathology. 2017; 185; 38-47. [PubMed: 28242001].
12. Liu et al., 2017: Liu F, Tang X, Sheng X, Xing J, Zhan W. Construction and evaluation of an Edwardsiella tarda DNA vaccine encoding outer membrane protein C. Microbial pathogenesis. 2017; 104; 238-247. [PubMed: 28137507].
13. Ma et al., 2014: Ma J, Xu J, Guan L, Hu T, Liu Q, Xiao J, Zhang Y. Cell-penetrating peptides mediated protein cross-membrane delivery and its use in bacterial vector vaccine. Fish & shellfish immunology. 2014; 39(1); 8-16. [PubMed: 24746937].
15. Song et al., 2013: Song M, Xie J, Peng X, Li H. Identification of protective immunogens from extracellular secretome of Edwardsiella tarda. Fish & shellfish immunology. 2013; 35(6); 1932-1936. [PubMed: 24099803].
16. Sun et al., 2010: Sun Y, Liu CS, Sun L. Identification of an Edwardsiella tarda surface antigen and analysis of its immunoprotective potential as a purified recombinant subunit vaccine and a surface-anchored subunit vaccine expressed by a fish commensal strain. Vaccine. 2010; 28(40); 6603-6608. [PubMed: 20673823].
17. Sun et al., 2011: Sun Y, Liu CS, Sun L. Construction and analysis of the immune effect of an Edwardsiella tarda DNA vaccine encoding a D15-like surface antigen. Fish & shellfish immunology. 2011; 30(1); 273-279. [PubMed: 21059395].
18. Sun et al., 2012: Sun Y, Zheng WJ, Hu YH, Sun BG, Sun L. Edwardsiella tarda Eta1, an in vivo-induced antigen that is involved in host infection. Infection and immunity. 2012; 80(8); 2948-2955. [PubMed: 22585967].
19. Trung et al., 2014: Trung Cao T, Tsai MA, Yang CD, Wang PC, Kuo TY, Gabriel Chen HC, Chen SC. Vaccine efficacy of glyceraldehyde-3-phosphate dehydrogenase (GAPDH) from Edwardsiella ictaluri against E. tarda in tilapia. The Journal of general and applied microbiology. 2014; 60(6); 241-250. [PubMed: 25742975].
20. Wang et al., 2010: Wang B, Mo ZL, Xiao P, Li J, Zou YX, Hao B, Li GY. EseD, a putative T3SS translocon component of Edwardsiella tarda, contributes to virulence in fish and is a candidate for vaccine development. Marine biotechnology (New York, N.Y.). 2010; 12(6); 678-685. [PubMed: 20072793].
21. Wang et al., 2013: Wang C, Hu YH, Chi H, Sun L. The major fimbrial subunit protein of Edwardsiella tarda: vaccine potential, adjuvant effect, and involvement in host infection. Fish & shellfish immunology. 2013; 35(3); 858-865. [PubMed: 23811351].
22. Xiao et al., 2011: Xiao J, Chen T, Wang Q, Liu Q, Wang X, Lv Y, Wu H, Zhang Y. Search for live attenuated vaccine candidate against edwardsiellosis by mutating virulence-related genes of fish pathogen Edwardsiella tarda. Letters in applied microbiology. 2011; ; . [PubMed: 21777261].
