Porcine parvovirus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- non-structural protein 1
(Protective antigen)
- VP1
(Protective antigen)
- VP2
(Protective antigen)
- Vaccine Information
- ERYSENG® PARVO
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae Bacterin (USDA: 4906.20)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
- Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
- Porcilis® Ery + Parvo + Lepto
- Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
- ReproCyc® ParvoFLEX
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10796 |
2. Disease: |
SMEDI, reproductive failure |
3. Introduction |
Porcine parvovirus (PPV) is the cause of reproductive failure in swine characterized by embryonic and fetal infection and death (SMEDI), generally without outward maternal clinical signs. The virus is ubiquitous throughout the world and is endemic in most swine herds. PPV can also potentiate the effects of infection with porcine circovirus type 2. The most common routes of infection for postnatal and prenatal pigs are oronasal and transplacental. Infection is endemic in most herds, and generally sows are immune. The virus can persist in the environment, as it is themostable and resistant to many common disinfectants. The major and usually only clinical response of PPV infection is maternal reproductive failure, such as infertility, abortion, stillbirth, neonatal death and reduced neonatal vitality (Mengeling, 2006). |
4. Host Ranges and Animal Models |
Pigs |
II. Vaccine Related Pathogen Genes |
1. non-structural protein 1 |
-
Gene Name :
non-structural protein 1
-
Sequence Strain (Species/Organism) :
Porcine parvovirus
-
NCBI Protein GI :
AAS93262
-
Other Database IDs :
CDD:255001
CDD:289218 CDD:279406 CDD:288933
-
Taxonomy ID :
10796
-
Protein Name :
non-structural protein 1
-
Protein pI :
6.85
-
Protein Weight :
73222.28
-
Protein Length :
731
-
Protein Note :
Rep protein catalytic domain like; pfam08724
-
Protein Sequence : Show Sequence
>AAS93262.1 non-structural protein 1 [Porcine parvovirus]
MAAGNTYSEEVLKATDWLQDNAQKEAFSYVFKTQKVNLNGKEIAWNNYNKDTTDAEMINLQRGAETSWDQ
ATDMEWESEIDSLTKRQVLIFDSLVKKCLFEGILQKNLSPSDCYWFIQHEHGQDTGYHCHVLLGGKGLQQ
AMGKWFRKQLNNLWSRWLIMQCKVPLTPVERIKLRELAEDGEWVSLLTYTHKQTKKQYTKMTHFGNMIAY
YFLNKKRKTTEREHGYYLSSDSGFMTNFLKEGERHLVSHLFTEANKPETVETTVTTAQEAKRGRIQTKKE
VSIKCTIRDLVNKGCTSIEDWMMTDPDSYIEMMAQTGGENLIKNTLEITTLTLARTKTAYDLILEKAKPS
MLPTFNISNTRTCKIFSMHNWNYIKVCHAITCVLNRQGGKRNTILFHGPASTGKSIIAQHIANLVGNVGC
YNAANVNFPFNDCTNKNLIWIEEAGNFSNQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNEDITK
VRVGCEERPEHTQPIRDRMLNINLTRKLPGDFGLLEETEWPLICAWLVKKGYQATMASYMHHWGNVPDWS
EKWEEPKMQTPINTPTDSQISTSVKTSPADNNYAATPIQEDLDLALALEPWSEPTTPTFTNLHLTPTPPD
SAIRTPSPTWSEIETDIRACFGENCAPTTNLE
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Qi and Cui, 2009)
|
2. VP1 |
-
Gene Name :
VP1
-
Sequence Strain (Species/Organism) :
Porcine parvovirus
-
NCBI Protein GI :
AFR43265
-
Other Database IDs :
CDD:285583
CDD:279128
-
Taxonomy ID :
10796
-
Protein Name :
VP1 protein
-
Protein pI :
8.35
-
Protein Weight :
79417.77
-
Protein Length :
786
-
Protein Note :
Parvovirus coat protein VP1; pfam08398
-
Protein Sequence : Show Sequence
>AFR43265.1 VP1 protein [Porcine parvovirus]
MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKET
EHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKA
KGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGEGLV
RITAHASRLIHLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVWFNPADWQLIS
NNMTEINLVSFEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTNNTLPYTPAAPRSETLGFYPW
LPTKPTQYRYYLSCIRNLNPPTYTGQSQQITDSIQTGLHSDIMFYTIENAVPIHLLRTGDEFSTGIYHFD
TKPLKLTHSWQTNRSLGLPPKLLTEPTTEGDQHSGTLPAANTRKGYHQTINNSYTEATAIRPAQVGYNTP
YMNFEYSNGGPFLTPIVPTADTQYNDDEPNGAIRFTMDYQHGHLTTSSQELERYTFNPQSKCGRAPKQQF
NQQAPLNLENTNNGTLLPSDPIGGKSNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHV
TAPFVCKNNPPGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTFTAKMRSSNMWNPIQQHTTTA
ENIGNYIPTNIGGIRMFPEYSQLIPRKLY
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Xie et al., 2010)
|
3. VP2 |
-
Gene Name :
VP2
-
Sequence Strain (Species/Organism) :
Porcine parvovirus
-
NCBI Protein GI :
AGZ94859
-
Other Database IDs :
CDD:279128
-
Taxonomy ID :
10796
-
Protein Name :
VP2
-
Protein pI :
6.16
-
Protein Weight :
62794.25
-
Protein Length :
626
-
Protein Note :
Parvovirus coat protein VP2; pfam00740
-
Protein Sequence : Show Sequence
>AGZ94859.1 VP2 [Porcine parvovirus]
MSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGEGLVRITAHASRLI
HLNMPEHETYKRIHVLNSESGVAGQMVQDDAHTQMVTPWSLIDANAWGVWFNPADWQLISNNMTEINLVS
FEQEIFNVVLKTITESATSPPTKIYNNDLTASLMVALDTNNTLPYTPAAPRSETLGFYPWLPTKPTQYRY
YLSCIRNLNPPTYTGQSQQITDSIQTGLHSDIMFYTIENAVPIHLLRTGDEFSTGIYHFDTKPLKLTHSW
QTNRSLGLPPKLLTEPTTEGDQHPGTLPAANTRKGYHQTMNNSYTEATAIRPAQVGYNTPYMNFEYSNGG
PFLTPIVPTADTQYNDDEPNGAIRFTMDYQHGHLTTSSQELERYTFNPQSKCGRAPKQQFNQQAPLNLEN
TNNGTLLPSDPIGGKSNMHFMNTLNTYGPLTALNNTAPVFPNGQIWDKELDTDLKPRLHVTAPFVCKNNP
PGQLFVKIAPNLTDDFNADSPQQPRIITYSNFWWKGTLTLTAKMRSSNMWNPIQQHTTTAENIGNYIPTN
IGGMRMFPEYSQLIPRKLY
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ji et al., 2017)
|
III. Vaccine Information |
|
|
|
|
|
|
1. ERYSENG® PARVO |
a. Type: |
Inactivated or "killed" vaccine |
b. Status: |
Licensed |
c. Host Species for Licensed Use: |
Baboon |
d. Preparation |
The vaccines were prepared and diluted following the manufacturer’s recommendations. (Sánchez-Matamoros et al., 2019) |
e. Immunization Route |
Intramuscular injection (i.m.) |
f. Description |
ERYSENG® PARVO (HIPRA) is a bivalent inactivated vaccine based on the inactivated E. rhusiopathiae strain R32E11 and the inactivated PPV strain NADL-2.(Sánchez-Matamoros et al., 2019) |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae Bacterin (USDA: 4906.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002290 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20) |
a. Manufacturer: |
Wyeth, Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002321 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002322 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002323 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002277 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20) |
a. Manufacturer: |
Pfizer, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002278 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002279 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002280 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002292 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002293 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002294 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002291 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002309 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002310 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002311 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002312 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002313 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002314 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Porcilis® Ery + Parvo + Lepto |
a. Type: |
Inactivated or "killed" vaccine |
b. Status: |
Licensed |
c. Host Species for Licensed Use: |
None |
d. Antigen |
Six relevant swine Leptospira antigens (serogroups Canicola, Icterohaemorrhagiae, Australis (Bratislava), Grippotyphosa, Pomona and Tarassovi) to an existing vaccine, Porcilis® Ery + Parvo(van et al., 2020) |
e. Immunization Route |
Intramuscular injection (i.m.) |
f. Virulence |
Virulent PPV-27a strain. (van et al., 2020) |
g. Description |
Porcilis® Ery+Parvo+Lepto is an octavalent inactivated ready-to-use vaccine that contains Erysipelothrix rhusiopathiae (Ery), porcine parvovirus (PPV), and six serogroups of Leptospira (Lepto).(van et al., 2020) |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002324 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. ReproCyc® ParvoFLEX |
a. Type: |
Subunit vaccine |
b. Status: |
Licensed |
c. Location Licensed: |
European (EU) market |
d. Host Species for Licensed Use: |
Pig |
e. Antigen |
Produces the protective viral protein (VP) 2 of PPV1. (Garcia-Morante et al., 2019) |
f. Immunization Route |
Intramuscular injection (i.m.) |
g. Description |
ReproCyc® ParvoFLEX (Boehringer Ingelheim Vetmedica GmbH, Ingelheim am Rhein, Germany) is a recently licensed monovalent subunit vaccine for pigs based on a recombinant baculoviral expression system producing the protective viral protein (VP) 2 of PPV1.(Garcia-Morante et al., 2019) |
|
|
|
|
|
|
|
|
IV. References |
1. Ji et al., 2017: Ji P, Liu Y, Chen Y, Wang A, Jiang D, Zhao B, Wang J, Chai S, Zhou E, Zhang G. Porcine parvovirus capsid protein expressed in Escherichia coli self-assembles into virus-like particles with high immunogenicity in mice and guinea pigs. Antiviral research. 2017; 139; 146-152. [PubMed: 28063996].
2. Qi and Cui, 2009: Qi T, Cui SJ. Expression, purification, and characterization of recombinant NS-1, the porcine parvovirus non-structural protein. Journal of virological methods. 2009; 157(1); 93-97. [PubMed: 19101593].
3. Xie et al., 2010: Xie HL, Wang Z, Cui SJ, Zhang CF, Cui YD. The epitope of the VP1 protein of porcine parvovirus. Virology journal. 2010; 7; 161. [PubMed: 20637107].
|