Leptospira spp. |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- ligA
(Protective antigen)
- ligB
(Protective antigen)
- ligB
(Protective antigen)
- lipL21
(Protective antigen)
- lipL32
(Protective antigen)
- lipL45
(Protective antigen)
- loa22
(Protective antigen)
- lsa21
(Protective antigen)
- mce
(Protective antigen)
- ompL1
(Protective antigen)
- ompL1
(Protective antigen)
- Vaccine Information
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00)
- Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00)
- Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30)
- Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21)
- Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21)
- Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25)
- Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00)
- Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
- Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20)
- Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27)
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27)
- Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
- Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
- Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20)
- Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1)
- Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22)
- Canine Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47A9.20)
- Canine Parvovirus Modified Live Virus Vaccine-Leptospira Canicola Icterohaemorrhagiae Bacterin (USDA: 47B1.20)
- Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
- Leptospira interrogans DNA vaccine pTARGET/ LigBrep
- Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4989.00)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21)
- Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20)
- Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22)
- Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23)
- Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24)
- Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20)
- Trichomonas Foetus Vaccine, Killed Protozoa-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4990.00)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
171 |
2. Disease: |
Leptospirosis |
3. Introduction |
Leptospirosis (also known as Weil's disease, Weil's syndrome, canicola fever, canefield fever, nanukayami fever, 7-day fever, Rat Catcher's Yellows, Fort Bragg fever, and Pretibial fever) is a bacterial zoonotic disease caused by spirochaetes of the genus Leptospira that affects humans and a wide range of animals, including mammals, birds, amphibians, and reptiles. The disease was first described by Adolf Weil in 1886 when he reported an "acute infectious disease with enlargement of spleen, jaundice and nephritis". Leptospira was first observed in 1907 from a post mortem renal tissue slice. In 1908, Inada and Ito first identified it as the causative organism and in 1916 noted its presence in rats. Though recognised among the world's most common zoonoses, leptospirosis is a relatively rare bacterial infection in humans. The infection is commonly transmitted to humans by allowing water that has been contaminated by animal urine to come in contact with unhealed breaks in the skin, the eyes, or with the mucous membranes. Outside of tropical areas, leptospirosis cases have a relatively distinct seasonality with most of them occurring August–September/February–March.
Leptospirosis is caused by a spirochaete bacterium called Leptospira spp. that has at least 5 serovars of importance in the United States and Canada causing disease in dogs (Icterohaemorrhagiae, Canicola, Pomona, Grippotyphosa, and Bratislava).There are other (less common) infectious strains. Genetically different leptospira organisms may be identical serologically and vice versa. Hence, an argument exists on the basis of strain identification. The traditional serologic system is seemingly more useful from a diagnostic and epidemiologic standpoint at the moment (which may change with further development and spread of technologies like PCR).
Leptospirosis is transmitted by the urine of an infected animal and is contagious as long as it is still moist. Although rats, mice and moles are important primary hosts, a wide range of other mammals including dogs, deer, rabbits, hedgehogs, cows, sheep, raccoons, possums, skunks, and certain marine mammals are able to carry and transmit the disease as secondary hosts. Dogs may lick the urine of an infected animal off the grass or soil, or drink from an infected puddle. There have been reports of "house dogs" contracting leptospirosis apparently from licking the urine of infected mice that entered the house. The type of habitats most likely to carry infective bacteria are muddy riverbanks, ditches, gullies, and muddy livestock rearing areas where there is regular passage of either wild or farm mammals. There is a direct correlation between the amount of rainfall and the incidence of leptospirosis, making it seasonal in temperate climates and year-round in tropical climates.
Leptospirosis is also transmitted by the semen of infected animals. Slaughterhouse workers may contract the disease through contact with infected blood or body fluids.
Humans become infected through contact with water, food, or soil containing urine from these infected animals. This may happen by swallowing contaminated food or water, or through skin contact. The disease is not known to be spread from person to person and cases of bacterial dissemination in convalescence are extremely rare in humans. Leptospirosis is common among water-sport enthusiasts in specific areas as prolonged immersion in water is known to promote the entry of the bacteria. Surfers and whitewater paddlers are at especially high risk in areas that have been shown to contain the bacteria, and can contract the disease by swallowing contaminated water, splashing contaminated water into their eyes or nose, or exposing open wounds to infected water. Occupations at risk include veterinarians, slaughterhouse workers, farmers, sewer workers, and people working on derelict buildings. Rowers are also sometimes known to contract the disease (Wiki: Leptospirosis). |
4. Host Ranges and Animal Models |
Leptospirosis is transmitted by the urine of an infected animal and is contagious as long as it is still moist. Although rats, mice and moles are important primary hosts, a wide range of other mammals including dogs, deer, rabbits, hedgehogs, cows, sheep, raccoons, possums, skunks, and certain marine mammals are able to carry and transmit the disease as secondary hosts (Wiki: Leptospirosis). |
II. Vaccine Related Pathogen Genes |
1. ligA |
-
Gene Name :
ligA
-
Sequence Strain (Species/Organism) :
Leptospira kirschneri serovar Kambale
-
NCBI Protein GI :
ACH98094
-
Other Database IDs :
CDD:214752
CDD:308144 CDD:322060
-
Taxonomy ID :
173
-
Protein Name :
LigA
-
Protein pI :
6.12
-
Protein Weight :
119806.65
-
Protein Length :
1285
-
Protein Note :
serogroup: Canicola
-
Protein Sequence : Show Sequence
>ACH98094.1 LigA [Leptospira interrogans]
MKKIFCISIFLSMFFQSCMSWPLLTSLAGLAAGKRGGDSSFFHLLLGNSDPTITRIELSYQDSSIANGTS
TTLEVTAIFDNGTNQNITDSTSIVPDSQSVVTIQGNRVRGIASGSSIIKAEYNGLYSEQKITVTPATLNS
IQVTSLESGILPKGTNRQFSAIGIFSDGSHQDISNDPLIVWSSSNPDLVQVDDSGLASGINLGTAHIRAS
FQSKQGAEEMTVGDAVLSQIQVTSNNPNIPLGKKQKLIATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
GILETADTGIVTISASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFTVTQAALTSIEVSPVLPSIAKGLT
QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDDNKGLGKAHAVGDTTITATLGKVSGKTWLTVVPA
VLTSIQINPVNPSLAKGLTQKFTATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
LTVSNTNAKRGLGSTLKQGTVKVTASMGGIEDSVDFTVTQATLTSIEVSPTRASIAKGMTQKFTATGIFT
DHSKKNITEQVTWKSSSKALSMLNAPGEEGTGKAIAVGNISITATLEKLSGKTDITVTPAVLTSIQISPV
KHCLVKGLTEKFSATGIYSDNSSKDITSAVTWHSSNNSVATISNTKGYQGQAHGTGTGTVDIKATLGNVS
SQVSKLSVTAAELIEIVLNPTSSHKAKGLTENFKATGVFTDNSTKDITDQVTWKSSNTAYAKISNATGSK
GVVNALSKGTSHISATLGSISSANATFQVTPAKVVSIEVIPNNISFAKGNSYQFKATGIYTDHSEADITE
QVTWSSSNPKIASVENTFGSAGLVNTTNIGSTNITAKLSDTVSGSSVLNVTPALLRYIMITPSYAGIEKG
YTKQFSAIGTYSDQSTKDLTEDVTWFSSNPSSVVIENTPGKKGLAFASELGEPDITVFYDHHTQSSYTPV
TVTESGIVNITISLSSISKTKGSTHQFKATGKFENGAEIDLTELVTWSSSNPTVVSISNVDDERGLATAL
SVGSSKISVDYNSISSSIDFEVTPEILASIKTEP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Evangelista et al., 2017)
|
2. ligB |
-
Gene Name :
ligB
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
-
NCBI Gene ID :
2771118
-
NCBI Protein GI :
45656362
-
Locus Tag :
LIC10464
-
Genbank Accession :
AE016823
-
Protein Accession :
YP_000448
-
Taxonomy ID :
267671
-
Chromosome No :
I
-
Gene Starting Position :
526394
-
Gene Ending Position :
532066
-
Gene Strand (Orientation) :
-
-
Protein Name :
hypothetical protein
-
Protein pI :
7.03
-
Protein Weight :
190366.08
-
Protein Length :
1890
-
Protein Note :
Big; identified by sequence similarity; ORF located using Blastx/Glimmer
-
DNA Sequence : Show Sequence
>NC_005823.1:526394-532066 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130, chromosome I, complete sequence
ATTATTGATTCTGTTGTCTGTAAATTTTGACCGGTTTATTTTTGTTTCCTACGCTTATATATACGAAATT
TACACCAAAATTCATTCCGGATATAGCCGAATAAATTTGACGATTGGTAACGTCTCTTAATCCGCCTATT
CCTATAGGTTCCCAGTTGTGTGATGAACTTCCAGGATTTTCAAGATTTGTTCTCCAGATTTGAATTCCGT
TTTCGTTATCAAAACCTATGTAGAGATAAGATCCACTTGCAACCATCATCGTCATACTGTGATTGGAATT
GTCTCCAAAGTTTGTAAATCCGGTTCCGTTATCTCCTACTAAAGACCAATCTTCTGCTTCGCAGGTTGTT
GTATCGCCGGTTAGAGTCGGATCACATTTCCAAAGTTGGGGTCTTCGATTTGTATAACTTCCGTCCGTAC
AACCTTCCACAGTTTGTAAACTTTGTCTGAGTCCGGAGTGATCTTCTTTCGTTACGCAGATCGTTCTTGT
TACATACAATCTTCCGTTAAATTCTGCGAATTGAGAGAATGCTTTATCCGCCGGAATTAAATTCCGATAC
TTTGTAAGCTCCAGTGAAAACCAATTGTTATGAGGAGAGTTATGCCACTTCGGATTGGATCTAGGTGCTG
TGTCTTTCCAACTGGAACAACGATTGCTCCCCTCACAAGGACTAGGATTTGCACTGGTAGAGTGTATTAT
ACTTCCATTATGTAGTGAATTTGGAAATCCTCCGTTTGCGGCGTAAAGTTTTTCTTTAAAAACGAATAGA
GAATCTATTCCCACATAATAACCCCAGTTGATCGAGGAGTTATCAGATGTATAAGTTTCATAATTGTCTG
CATCCTCCACGGAGAGGCCGCCGAAATAAGGCATTCTATCGATTCTAAAACGATTACCGCGGTATCCGTC
AGAGGCGTCACAATTGTTTCCGGCTGCACATCTATTTTGATCGGATGTATTAAAGGTGATTTTACCGAAA
TCAGGTGCGTTTAGATTTTTATTTTTTTTTGCAAAACCCACATGGATCCGATCGTCTATAACCGCGATAG
ATGAAGTTCCTGCAGTCGCCGTTCCAGTAATTTCTCCCATATCGATATATTTAAAATTAAGATTTGTATC
GGTATCTGAGGAATAATAGAGATAGTCGAATCTCCTTGGTCTTGAACCTGCTATAAAAATATGAGATTTT
TTGTTTAATGATCCGATGGCAAAAACTCCACGTCCATCTTCGTTATCCGGACCACATCCAGTAGTAATGT
CTGCACTATTGAGAGTACAACCGGTATGACCGATCGTAACGTAATTCGGAACCGGAATTCCTCCATCTCT
TGAAGACGCACGGTTATCGGCATTTATATCTTTGGTAAAAGAGAAAAAAATAGATTCGGGAAAAGTTCCG
TCGTAATTGAATCGAGCTGCTTGGTTTCCTTTTACATTCGGTCCTAGATAGATTTGATTGTTGTAATCTA
CAAGAAAGCCGAAATCGGAACCGTCTCCAAAAGGATCTGACATGATCGGGCCATCCATAAAGTTGAGAGG
GGAATTTCCACAACCTATAAAGTTGATTCTATCTTTCGGAGAAGATTGTAGGTTTTCTTGATCGAATGAA
TCTCTAATTGCTCCCCAGGATTTGTTGTCAAAGCCGTCTCCGTTCAAATCATTTGCGGCGATGATCGTAT
ATTGACCACCTGATTGAAGAAGGGAGTGTGTTAAACATATTTTCGAGGAGTCTGCCGGTGCTCCACCGCA
TACTTTTCCATCTAAAATTCTAACGCTCGTAATACTTCCCAATGAAGACACACCTGCAAATTTATATCTG
GATTCACACTGGGACGGATTTGAACATTCCACGGATTTTGTTGCTTCCTTTCCCGAATATAAAGGTTTGG
AAAAAGAAACGATCACTTGGTTTAAGGAATTACAAACTGCACTTGTAAGTTTGAGTTGTTCTTTTCCTAT
AAAATCAGAGTTATTTGGACAACTTAAGGAATTTGGAATGGAAGAAAGATCGTGAATTCCTTGTTTGTTG
ACTACAAGTGTGTATGATTTGTTTAAGATTTGTGAATGTGAAAGTGTGATCGTAAAAGTATTTTTACTTC
CTTTGATACTACTAAGAGAAAAATCTGCGGTTTGAGAATTGGAATTGAAGTCCGTATTATCTGAACAATG
TCCTATAAAATTGGAACTATCAATTATTTTGTAATTGGATAAATCAAGGGCTTCCTTATTGTTTATGGAT
TCTGAATATACAACTTGGATGGTAGTAGGTGATAAGGAAACTACCGATTGAACCGTTGGAGCTATCGTGT
CCGTTTTGTTTACTGTGAGGATTGTATTTCCAGATACTGAACCGTAGGTCGCTGTGATTATAGAGTTTCC
AGAAGCAATCCCTGTAACCAATCCTTTCGTTTTAGATGCGTTACTCACCTTTGCCTGAGATTTATTTGAG
CTGGACCATGTAACCGAAGAAGTTAAATCCGCTTTGGTCCCATCCGAATACGTTCCCACCGCGAAAAATT
GTTTTGATACGGTTGCGTTTATATTTGTATTGATAGGAGATATTGAAATCGAAGAAAGGGTTGCTGCGCT
GACCGTTATGTCTATGTTTTCCGAGATGGAATTGTAAGTCGCAGTGATTTTGCTGTTTCCAATCTGTAAA
GCGGTCGCTTTTCCCTTGGTTTCGGTCGAATTAGAGATGCTGATCGAGTCAGAATTGGAACTGGACCAGG
TAACTGAATCGCTGATGTCCTGAATGGTGGAGTCTGAATAAACGCCAAGCGCAGTATATTGTTGGGTAAG
TCCCTTGGCGATGTTATTGTTGACTGGATTGATTTTAATGGAATCTAACGTGGCAGCACTTACATTAAAA
TTTATTTTATTACTGCTTATAGAATTGTAAATCGCAGAGATGTTGGAAGAACCTATTGAAAGTGCGGTTG
CTAAACCTTTTGCATTGGCAGCGTTATTGATAGGGGCAACGTCGGATTTGGAAGAATACCAGGTCACAAG
ATTCGTAATTTCTTGTTCAGAGCCATCTATAAAAGTTCCGATCGCTTTAAATTGCTGGGTCAATCCTTTG
GCTATTGAACTTGAGGAAGGACTGATAGTTATACTTTTCAGTTTTAAGTCAGTGACTGTAATCGGAATTG
GGGAGCTTTGGATGAATTTGTAGACGGCCTTAATATTCGAACTTCCTAATTTAGAGGCTGTCGCTATACC
TTTTTTACCGGAAGTGTTTTCGATCTCAATCTTAGATGGATCGGAAGAAATCCAAGTTACAAGCTGAGTC
AAATTTTGAGTAGATTTATCTGAAAAGATACCAGTCGCTTTAAATTGTTTTGTAAGACCGTGAGTGATAG
AGTTAATCGTCGGTGTTATCTCGATAGAAGTAAGAAGTGCAGGAGTGACATTCAAAACGGAAGAGCCAGA
TATGGAGTCTATCGTTGCTTTAATATTTGTATTTCCGGTAGCCACTGTTGTAACCGAACCTGTAACGTTG
TTAACCATTGCTTTTCCGGGATTGGAAGAAGACCAGGTAGCTAGGGCAGTCACGTCTTGTACGGAATGAT
CCGTATATGTTCCGGTGGCTTTAAATTGTCGTATTAGACCTTTTGCAACTGACGGATTTATAGGTGTTAC
GGCAATGGAAATCAATTGTGCCGGAGTTACCTTTAAAATTACTTTAGAACTTTTGATTGAACCGAGGGCT
GCGGATATTTCACTCGATCCTGGAGTGAGTGTATTTGTAATACCTTTACTTCCACTGGTATTTTTAATTT
CAGCAATATCCGTATTAGAGGAATTCCAGGTAACTTGATTTGTAATATCGGAATTTGAGTTATCCGTAAA
GATACCAGTAGCCTTGAATCTTTCTGTGAGTCCCTTTGCTTTGGAAGCAGCAGCCGGTGTGATTTGGATT
TCAACAAGCTTTGCAGCTGTAACAGATAACGTAGAAACCGGACTACTTACCTTTCCGAATGTGGCTTTAA
TATCCGTTGCTCCTGTAGCTGCTCCGTAAGCGTTTCCTTGATTTTTTTGGGCGTTTGAAATCGTCGCGAT
TGAAGAATCGGATGAGAACCACGTAACAGCGGAAGTAATGTCCTTGTTAGAGTTGTCAGAGTAGATCCCA
GTAGCCGTAAATTTTTGAGTTAACCCTTTTGCAAGAGAAGGATTTACAGGATTGATTTGAATAGAAGTGA
GAACCGCAGGAACTACAGTAAACCAAGTGTTACCTGAAACTTTTCCTAAGGTTGCGGTAATAGTCGTGTT
TCCAACTGAGTTGGTTTTTCCCAGACCTTTATTGTTGTCTAAGTTAGACACGCTTACGATTGCTGAAGAA
GAATTCCAAGTGACTTGATCCGTAATATCCTTCTTAGAGTTATCCGTAAAAATCCCGATCGCAGTAAACT
TTTGAGTTAGTCCTTTTGCAATGGAAGTGCGAGTTGGAGAGACTTCGATGGAAGTCAATGCAGCTTGTGT
AACTTTAAAATCAGTGGATCCTTGTATTCCACCGATGGAAGCAGTGACTTTAACATTCCCTTGGTTGAGT
GTGGAAGCTAATCCGTGGCTATCACTTGCATTGGAAATTGAGAGAATATCGGTATTAGAAGAATCCCAAG
TAACTTGGTCGGTAATATCCGAGTTTGAATTATCTGTAAAGATCCCTGTAGCTTTAAAGTTTTCTTGTAA
ACCTTTTGCAACTGTAGAATTTGTCGGAGAAACAGAAATAGAAACTAAGGCTGCTGGAGTAACGATTAGT
TTTACGGATCCGATTATATTCTCGCTAGAAGCAGAAACAGTGACAATACCAGTATCAGCTGTTTCTAATA
TTCCGTTGTTTTGAATATTAGCGATAGTGGAATTAGAAGAATTCCAAATAACAGAAGAGGAAATATCCCT
GTTAGAGTTATCCGAATAGATTCCCGTAGCTGTTAGTTTTTGTTTTTTTCCGAGAGGAATATTCAGATCG
TTTGAAGTTACTTGGATTTGAGAGAGAACAGCATCTCCAACGGTCATTTCTTCAGCCCCTTGTTTTGATT
GAAAGGATGCACGAATATGAGCTGTTCCTAAATTGATCCCTGATGCCAACCCTGAATCATCTACTCGAAC
CAAATCAGGATTACTGGAAGACCAAACGATCAGTGGTTCGTTGGAAATATCCTGATGAGAACCATCCGAA
AAGATACCGATGGCTGAGAATTGACGATTAGTACCTTTAGGTAGTATACCTGACTCTAAACTCGTAACTT
GAATTGAGTTAAGAATGGCTGGTGTAACGGTAATTTTTTGTTCAGAGTATAGGCCGTTGTATTCTGCTTT
TATAATGGAAGAACCAGAAGCGATTCCTTTGACTCTGTTGCCTTCGATTGTTACAACGGATTGGGAATCG
GGGACGATGGATGTCAAATCCGTAATATTCTGATTTGTTCCGTTATCAAAGATTGCGGTAACTTCTAGGG
TTGTACTGGTACCGTTTGCGATAGAAGAATCTTGATAACTAAGTTCGATTCTTGTAATAGTCGGATTGAA
GTTACCTAACAGAAGGTGGAAAAAGGACAGCCCATTACTTTTTTTACCAGCGGTTAATCCTACCAGACCG
GTTAAAAGTGGCCAAGACATACAACTTTGAAAAAACATCGAAAGAAAAATCGAAATACAAAATATTTTCT
TCA
-
Protein Sequence : Show Sequence
>YP_000448.1 hypothetical protein LIC10464 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
MKKIFCISIFLSMFFQSCMSWPLLTGLVGLTAGKKSNGLSFFHLLLGNFNPTITRIELSYQDSSIANGTS
TTLEVTAIFDNGTNQNITDLTSIVPDSQSVVTIEGNRVKGIASGSSIIKAEYNGLYSEQKITVTPAILNS
IQVTSLESGILPKGTNRQFSAIGIFSDGSHQDISNEPLIVWSSSNPDLVRVDDSGLASGINLGTAHIRAS
FQSKQGAEEMTVGDAVLSQIQVTSNDLNIPLGKKQKLTATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
GILETADTGIVTVSASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQAALTSIEVSPTRTSIAKGLT
QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDNNKGLGKTNSVGNTTITATLGKVSGNTWFTVVPA
VLTSIQINPVNPSLAKGLTQKFTATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
AEIKNTSGSKGITNTLTPGSSEISAALGSIKSSKVILKVTPAQLISIAVTPINPSVAKGLIRQFKATGTY
TDHSVQDVTALATWSSSNPGKAMVNNVTGSVTTVATGNTNIKATIDSISGSSVLNVTPALLTSIEITPTI
NSITHGLTKQFKATGIFSDKSTQNLTQLVTWISSDPSKIEIENTSGKKGIATASKLGSSNIKAVYKFIQS
SPIPITVTDLKLKSITISPSSSSIAKGLTQQFKAIGTFIDGSEQEITNLVTWYSSKSDVAPINNAANAKG
LATALSIGSSNISAIYNSISSNKINFNVSAATLDSIKINPVNNNIAKGLTQQYTALGVYSDSTIQDISDS
VTWSSSNSDSISISNSTETKGKATALQIGNSKITATYNSISENIDITVSAATLSSISISPINTNINATVS
KQFFAVGTYSDGTKADLTSSVTWSSSNKSQAKVSNASKTKGLVTGIASGNSIITATYGSVSGNTILTVNK
TDTIAPTVQSVVSLSPTTIQVVYSESINNKEALDLSNYKIIDSSNFIGHCSDNTDFNSNSQTADFSLSSI
KGSKNTFTITLSHSQILNKSYTLVVNKQGIHDLSSIPNSLSCPNNSDFIGKEQLKLTSAVCNSLNQVIVS
FSKPLYSGKEATKSVECSNPSQCESRYKFAGVSSLGSITSVRILDGKVCGGAPADSSKICLTHSLLQSGG
QYTIIAANDLNGDGFDNKSWGAIRDSFDQENLQSSPKDRINFIGCGNSPLNFMDGPIMSDPFGDGSDFGF
LVDYNNQIYLGPNVKGNQAARFNYDGTFPESIFFSFTKDINADNRASSRDGGIPVPNYVTIGHTGCTLNS
ADITTGCGPDNEDGRGVFAIGSLNKKSHIFIAGSRPRRFDYLYYSSDTDTNLNFKYIDMGEITGTATAGT
SSIAVIDDRIHVGFAKKNKNLNAPDFGKITFNTSDQNRCAAGNNCDASDGYRGNRFRIDRMPYFGGLSVE
DADNYETYTSDNSSINWGYYVGIDSLFVFKEKLYAANGGFPNSLHNGSIIHSTSANPSPCEGSNRCSSWK
DTAPRSNPKWHNSPHNNWFSLELTKYRNLIPADKAFSQFAEFNGRLYVTRTICVTKEDHSGLRQSLQTVE
GCTDGSYTNRRPQLWKCDPTLTGDTTTCEAEDWSLVGDNGTGFTNFGDNSNHSMTMMVASGSYLYIGFDN
ENGIQIWRTNLENPGSSSHNWEPIGIGGLRDVTNRQIYSAISGMNFGVNFVYISVGNKNKPVKIYRQQNQ
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Leptospira interrogans DNA vaccine pTARGET/ LigBrep
|
3. ligB |
-
Gene Name :
ligB
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Pomona
-
NCBI Protein GI :
ACH89908
-
Other Database IDs :
CDD:295441
CDD:214752 CDD:280521
-
Taxonomy ID :
44276
-
Protein Name :
LigB
-
Protein pI :
7.08
-
Protein Weight :
190537.51
-
Protein Length :
1983
-
Protein Note :
Bacterial Ig-like domain (group 2); cl02708
-
Protein Sequence : Show Sequence
>ACH89908.1 LigB, partial [Leptospira interrogans serovar Pomona]
MKKIFCISIFLSMFFQGCMSWPLLTGLVGLTAGKKSNGLSFFHLLLGNSNPTITRIELSYQDSSIANGTS
TTLEVTAIFDNGTNQNITDSTSIVPDSQSVVTIQGNRVRGIASGSSIIKAEYNGLYSEQKITVTPATLNS
IQVTSLGSGILPKGTNRQFSAIGIFSDGSHQDISNDPLIVWSSSNPDLVQVDDSGLASGINLGTAHIRAS
FQSKQGAEEMTVGDAVLSQIQVTSNNPNIPLGKKQKLIATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
GILETVDTGIVTISASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQAALTSIEVSPVLPSIAKGLT
QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDDNKGLGKAHAVGDTTITATLGKVSGKTWLTVVPA
VLTSIQINPVNPSLAKGLTQKFSATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
AEITNTSGSKGITNTLTPGSSEISAALGSIKSSKVILKVTPAQLISIAVTPINPSVAKGLIRQFKATGTY
TDHSVQDVTALATWSSSNPRKAMVNNVTGSVTTVATGNTNIKATIDSISGSSVLNVTPALLTSIEITPTI
NSITHGLTKQFKATGIFSDKSTQNLTQLVTWISSDPSKIEIENTSGKKGIATASKLGSSNIKAVYKFIQS
SPIPITVTDLKLKSITISPSSSSIAKGLTQQFKAIGTFIDGSEQEITNLVTWYSSKSDVAPINNAANEKG
LATALSIGSSDIYAIYNSISSNKINFNVSAATLDSIKINPVNNNIAKGLTQQYTALGVYSDSTIQDISDS
VTWSSSNSSSISISNSTETKGKATALQIGNSKITATYNSISENIDITVSAATLSSISISPINTNINTTVS
KQFFAVGTYSDGTKADLTSSVTWSSSNQSQAKVSNASETKGLVTGIASGNPTIIATYGSVSGNTILTVNK
TDTIAPTVQSVVSLSPTTIQVVYSESINNKEALDLSNYKIINSSNFIGHCSDNTDFNSNSQTADFSLSSI
KGSKNTFTITLSHSQILNKSYTLVVNKQGIHDLSSIPNSLSCPNNSDFMGKEQLKLTSAVCNSLNQVIVS
FSKPLYSGKEVTKSVECSNPSQCESRYKFAGVSSLGSITSVRILDGKVCGGAPADSSKICLTHSLLQSGG
QYTIIAANDLNGDGFDNKSWGAIRDSFDQENLQPSPKDRINFIGCGNSPLNFMDGPIVSDPFGDGSDFGS
LVDYNNQIYLGPNVKGNQATRFHYDGTFPESIFFSFTKDINATNRASSRDGGIPVPNYVTIGHTGCTLNT
ADITTGCGPDNENGRGVFATGSLNKKSHIFIAGSKPKRFNYLYYSSDTDTNLDFKYIDMGEITGLATAGT
SSIAVLDDRIHVGFAKRNQNLNAPDFGKITFNTSEQNRCAAGNNCEASDGYRGNRFRIDRMPYFGGGSVD
AVNYRTYKSDNSSINWGYYVGIDSLFVFKEKLYAANGGFPNSLHNGSIIHSTSANPSPCEEINRCSNWKD
TAPRSNPKWHNSPHNNWFSLELTKYRNLIPADKAFSQFAEFNGRLYVTRTICVTKEDNSGLRQSLQTVEG
CTDGSYTNRRPQLWKCDPTLTGDTTTCEAEDWSLVGDDGTGFTNFGDHSNHSMTMMVASGSYLYIGFDNE
NGIQIWRTNLENPGSSSHDWEPIGIGGLRDVTNRQIYSAISGMNFGVNFVYISVGNKNKPVKIYRQQNQ
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Conrad et al., 2017)
|
4. lipL21 |
-
Gene Name :
lipL21
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
-
NCBI Protein GI :
AAS68648
-
Taxonomy ID :
267671
-
Protein Name :
LipL21
-
Protein pI :
7.72
-
Protein Weight :
18906.6
-
Protein Length :
274
-
Protein Note :
outermembrane lipoprotein; identified by sequence similarity; putative; ORF located using Blastx/Glimmer
-
Protein Sequence : Show Sequence
>AAS68648.1 LipL21 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
MINRLIALSLATMIFAACSSTDTGQKDATTVGDGGWTFEGWGGPPEQRNDGKTPRDTNPKDWYYIKFSSR
ASGKAVAKKSQAMMQSTCREASRLQGASDVVKKMVGETVESASGVSDGEATASVIVSQSQGVVKGVGVYE
CKATGSGSDPKDVSKDNWEECQCVIYAKFPGGKDALVAKAQEVSKQ
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Lin et al., 2016)
|
5. lipL32 |
-
Gene Name :
lipL32
-
Sequence Strain (Species/Organism) :
Leptospira mayottensis 200901116
-
NCBI Protein GI :
AEZ53269
-
Other Database IDs :
CDD:288920
-
Taxonomy ID :
1192864
-
Protein Name :
LipL32
-
Protein pI :
4.31
-
Protein Weight :
16281.3
-
Protein Length :
225
-
Protein Note :
Leptospira cf. borgpetersenii
-
Protein Sequence : Show Sequence
>AEZ53269.1 LipL32, partial [Leptospira mayottensis 200901116]
ISVALFASITACGAFGGLPSLKSSFVLSESTVPGTNETVKTFLPYGTVINYYGYIKPGQAPDGLVDGSKK
AYYLYVWVPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPNWFDTWIRVERMSAIMPDQI
AKAAKAKPVQKLDDDDDG
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Lin et al., 2016)
|
6. lipL45 |
-
Gene Name :
lipL45
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Lai str. 56601]
-
NCBI Protein GI :
AAN49494
-
Other Database IDs :
CDD:309765
CDD:331332
-
Taxonomy ID :
189518
-
Protein Name :
LipL45
-
Protein pI :
8.37
-
Protein Weight :
38430.65
-
Protein Length :
462
-
Protein Note :
FecR protein; pfam04773
-
Protein Sequence : Show Sequence
>AAN49494.2 LipL45 [Leptospira interrogans serovar Lai str. 56601]
MKKFLIVFSSVLTTGLLVFNACKKPTESSKAAATKGNSPSAVVVFSVGEAKILHADLTEEKAALGASLKT
GDKVSTKQKSKVDIQFADGSAIRISENSVIDFDALSINSHGNSDTRLALVSGKVFAKVNKASKEDQFSVV
TPTAIAGVRGTSFIVDRSKSDKAVVKVLDGAVAVAPRVVVLEGLSDEEIAKNEDLKKIQQTVASSEIVLE
KNQASVVKADEKSLDVKDTSKISEKNITGVVKKLDNSGISKKEEEEIRTIVTVDKDTTEKMVRLNEESSG
KVDEQKAAVLEAERKKLESEVAARQEEEAKKFKQVLISAPKELKSSKDIVNYYERIEKIIMMDGSSMIGA
IVDQQGSTMIVHTEQGIKKINQADVQEVIYDFQTKAKF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Vijayachari et al., 2015)
|
7. loa22 |
-
Gene Name :
loa22
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Australis
-
NCBI Protein GI :
AIZ46906
-
Other Database IDs :
CDD:143586
-
Taxonomy ID :
211882
-
Protein Name :
Loa22
-
Protein pI :
5.36
-
Protein Weight :
17568.17
-
Protein Length :
240
-
Protein Note :
Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; cd07185
-
Protein Sequence : Show Sequence
>AIZ46906.1 Loa22, partial [Leptospira interrogans serovar Australis]
SFTLCSSAEKKEESAAPEPSTQEQSAAANRNVDVNSPEAIADSLNEKLKDFRYPDGLTRPGFSYKKADVT
PGDFSEWSKTNAPVIKEGLGKLPDSYALEITGHTDAIGPEQAEGAKKGNIFYSELRANAVKQALIKQGIP
ANRIVTKGAGSSEPVSGLDAKDAKNR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Umthong et al., 2015)
|
8. lsa21 |
-
Gene Name :
lsa21
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Australis
-
NCBI Protein GI :
ADB11053
-
Taxonomy ID :
211882
-
Protein Name :
Lsa21
-
Protein pI :
7.25
-
Protein Weight :
14946.43
-
Protein Length :
218
-
Protein Sequence : Show Sequence
>ADB11053.1 Lsa21, partial [Leptospira interrogans serovar Australis]
TQLLNTDCVTSSEVVSDSYNKTTITFENKPQYYNSPSGNVVPKAIMPILIKKGQTIQVSSITTNVKYEAT
NQDLTFLFRKDGCHGTNSEIATYAGATNTNVFLGNTNTVSLTQFKFTADYNGIILIVGKNLGASLPGDIR
VNVF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Atzingen et al., 2012)
|
9. mce |
-
Gene Name :
mce
-
Sequence Strain (Species/Organism) :
Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
-
NCBI Protein GI :
ADA57469
-
Other Database IDs :
CDD:224380
CDD:280608
-
Taxonomy ID :
280499
-
Protein Name :
Mce
-
Protein pI :
6.07
-
Protein Weight :
26482.45
-
Protein Length :
312
-
Protein Note :
ABC-type transporter Mla maintaining outer membrane lipid asymmetry, periplasmic component MlaD [Cell wall/membrane/envelope biogenesis]; COG1463
-
Protein Sequence : Show Sequence
>ADA57469.1 Mce [Leptospira interrogans serovar Wolffi]
MNMNSLRYLLVGIIFTAAITVVGYFTIITEGGPIKKKGEFMKVTFRNAEGIKVGNKVTVQGVPFGYVSAI
RLIQIDENGTEVQSGEMGIGTRVEITMLLREKISLYDNYDIIIKNESLLTGRVIAIDPGTADLEPKQLKT
RTIPITMIDYKTTGSLKGRVLQDPLVSLSELISENRGDIRKTFSNIADITTKINTGDGSLGRLINNDDVH
KNVNTVLTDAQIVLRELREGLEDTREQTPVTSFIRAALSAF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Fernandes et al., 2017)
|
10. ompL1 |
-
Gene Name :
ompL1
-
Sequence Strain (Species/Organism) :
Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
-
NCBI Gene ID :
2769678
-
NCBI Protein GI :
45656861
-
Locus Tag :
LIC10973
-
Genbank Accession :
AE016823
-
Protein Accession :
YP_000947
-
Taxonomy ID :
267671
-
Chromosome No :
I
-
Gene Starting Position :
1173341
-
Gene Ending Position :
1174303
-
Gene Strand (Orientation) :
-
-
Protein Name :
outer membrane protein
-
Protein pI :
8.87
-
Protein Weight :
31373.06
-
Protein Length :
320
-
Protein Note :
contains porin activity; identified by sequence similarity; ORF located using Blastx/Glimmer
-
DNA Sequence : Show Sequence
>NC_005823.1:1173341-1174303 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130, chromosome I, complete sequence
CTTAGAGTTCGTGTTTATAACCGAATCTGTAGATTTGCCCACCGACAACGATTGGATATGCAGGAAAAGG
AGAAAGGTTCGTAGCTCCTCCTGCAGATTGAGTTTTACCAACTGCATACGCAGCAGACATGATCGTTTCT
AATTCAAGAAAAACGTGTCCTTTATCGGTTACTCTGGCCTGAGTTCCAATTAAAAAGTTAGGAGCAATTC
CAGAAGTTCTAAATCGAACGTGTTCACGAGTCGTGACTGGATCTGTTCCGTCTGCGATCAAGTTTGCAAC
ACTTCCCGCTCCCGCTGCAGCTAAAATGTCATGACCTCCTTTGAGGTTGTTTGATCCGTTTAAACTCCAT
CCACCATTGAAATAGTTTAAACCTGCTCCCATATATATTGCAGCGTCTTCAGTAACATTCAATTTGATAC
CAACGGTTGCAGGAATGACGATAGAACTAAAACCCCAAGTCATATCTACAATGTTATAACCAGCGATGTC
TGCTTTTGTAATACCGCCAGAAATTTTTTGAGTATATTCTGCAGCAACTCTCCAGAAAAAATATTTACCA
AAGTCGGACTCATAACCTACCATCAAGTTTCCTCCGACCATGGCGCCTTTAGTGCTTCTTGCGTTGATCA
AGCCGCCAGTAGTTCTATCGAGGGTAATCAATTTATTTTCAGCAGGAATCGCTTTTCTGGGAGCAACTCC
TAGATAATTTCCTTCACCTGTAGGTTTTCCTGGATTTTGTACACAAGTAGGATCGTTTGGACCTACTGTA
CAAGTATCTGTTGATCGGACCGGGCCATAATAACTTGCAGCGTCTAAACCATCTTTGGTGATGGTTCCTC
CTAATTGTCCTAGGTCTAACTGTAACCCAAATCCTACAATTGCATATGTTTTTGCACTTAGGCTTGCAGC
CGAAGATAATGCTACGGCTAAAATGAGCAATGCCTTACTTATGTTACGGATCA
-
Protein Sequence : Show Sequence
>YP_000947.1 outer membrane protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
MIRNISKALLILAVALSSAASLSAKTYAIVGFGLQLDLGQLGGTITKDGLDAASYYGPVRSTDTCTVGPN
DPTCVQNPGKPTGEGNYLGVAPRKAIPAENKLITLDRTTGGLINARSTKGAMVGGNLMVGYESDFGKYFF
WRVAAEYTQKISGGITKADIAGYNIVDMTWGFSSIVIPATVGIKLNVTEDAAIYMGAGLNYFNGGWSLNG
SNNLKGGHDILAAAGAGSVANLIADGTDPVTTREHVRFRTSGIAPNFLIGTQARVTDKGHVFLELETIMS
AAYAVGKTQSAGGATNLSPFPAYPIVVGGQIYRFGYKHEL
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
|
11. ompL1 |
-
Gene Name :
ompL1
-
Sequence Strain (Species/Organism) :
Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
-
NCBI Protein GI :
ABJ75260
-
Other Database IDs :
CDD:288277
-
Taxonomy ID :
355277
-
Protein Name :
OmpL1
-
Protein pI :
8.88
-
Protein Weight :
31936.76
-
Protein Length :
404
-
Protein Note :
Leptospira porin protein OmpL1; pfam11389
-
Protein Sequence : Show Sequence
>ABJ75260.1 OmpL1 [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
MIRNMSKVLFALAVVFSSAESLSAKSYAIVGFGLQLDLGQLGGTITKDGLDAATYYGPVRSTNTCTVNAN
DPTCVQNPSKPAGEGNYVGVGTRRAIAAENRLITLDRTTGGIINARSTKGAMVGGNLMVGYESDFGKYFF
WRVAAEYTQKISGGITKADIAGLNIVDMTWGFSAIVIPATVGIKLNVTEDAAVYMGAGLNYFNGGWSLNG
MNNIKGGHDILAAAGVTSIANLLADGTDPITTREHIRFRATGIAPNFLIGTQARVTDKGHVFLELETIMS
AAYSVGKTQSIGGASTLAPFPTYPIVVGGQIYRFGYKYEL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Fernandes et al., 2017)
|
III. Vaccine Information |
|
|
|
|
|
|
1. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4019.00) |
a. Manufacturer: |
Wyeth, Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001880 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4059.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001881 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4069.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001882 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001883 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Bovine Rhinotracheitis Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4089.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001884 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4129.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001892 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4179.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001893 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Bovine Rhinotracheitis-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4209.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001894 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001903 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001904 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001907 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001908 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001914 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001915 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001916 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001917 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001918 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001919 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001920 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001922 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001931 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001932 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001933 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001934 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20) |
a. Manufacturer: |
Wyeth, Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001935 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001936 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001937 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001951 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001952 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001953 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001954 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001955 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001959 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001960 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001962 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001963 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001964 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001965 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001966 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001967 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001975 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001976 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001978 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
44. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001979 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
45. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001980 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001981 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
47. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001982 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
48. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001983 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
49. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001984 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
50. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001985 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
51. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001990 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
52. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001991 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
53. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001992 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
54. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001993 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
55. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001994 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
56. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001995 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
57. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001996 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
58. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001997 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
59. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001998 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
60. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001999 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
61. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002000 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
62. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002001 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
63. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002002 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
64. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002003 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
65. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002013 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
66. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002014 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
67. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002015 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
68. Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002023 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
69. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002025 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
70. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002026 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
71. Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0002027 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
72. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002244 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
73. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002243 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
74. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002222 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
75. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002224 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
76. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002223 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
77. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002225 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
78. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002221 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
79. Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002220 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
80. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4629.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002207 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
81. Canine Distemper-Adenovirus Type 2 Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4629.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002206 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
82. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002219 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
83. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002231 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
84. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002234 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
85. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002246 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
86. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002230 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
87. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002232 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
88. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002233 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
89. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002226 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
90. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002227 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
91. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002229 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
92. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002236 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
93. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002235 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
94. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002237 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
95. Canine Distemper-Adenovirus Type 2-Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4659.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002218 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
96. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4637.29) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002211 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
97. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 4639.25) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002214 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
98. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47K1.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002245 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
99. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.27) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002215 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
100. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 4639.28) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002216 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
101. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.20)_ |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Licensed |
d. Location Licensed: |
USA |
e. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
102. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002209 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
103. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4637.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002210 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
104. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002212 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
105. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002213 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
106. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J8.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002228 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
107. Canine Distemper-Adenovirus Type 2-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4639.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002217 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
108. Canine Distemper-Hepatitis-Parainfluenza-Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47P9.22) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002247 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
109. Canine Parainfluenza Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 47A9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0004213 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
110. Canine Parvovirus Modified Live Virus Vaccine-Leptospira Canicola Icterohaemorrhagiae Bacterin (USDA: 47B1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002240 |
c. Status: |
Licensed |
d. Location Licensed: |
USA |
e. Host Species for Licensed Use: |
Gray wolf |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
111. Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+) |
a. Vaccine Ontology ID: |
VO_0004562 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Hamsters |
e. Gene Engineering of
ompL1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pcDNA3.1(+) (Maneewatch et al., 2007) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Hamster Response |
- Vaccine Immune Response Type:
VO_0003057
- Efficacy:
The vaccine was shown to confer the delay in the death time and reduced morbidity in the vaccinated animals when compared to animals immunized with the plasmid alone or PBS. Hamsters of group 2 (mock) and group 3 (positive leptospirosis) were all dead between days 5 and 6 post-challenge. For the vaccinated group, two hamsters were dead on day 9, one each died on days 11 and 18, respectively. Two hamsters survived the lethal Leptospira challenge until day 21 when they were sacrificed (Maneewatch et al., 2007).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
112. Leptospira interrogans DNA vaccine pTARGET/ LigBrep |
a. Vaccine Ontology ID: |
VO_0004563 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Hamsters |
e. Gene Engineering of
ligB |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pTARGET (Forster et al., 2013) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Hamster Response |
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
The vaccine induced an IgG antibody response and, additionally, conferred sterilizing immunity in 80% of the surviving animals (Forster et al., 2013).
- Efficacy:
Immunization with a DNA vaccine encoding LigBrep resulted in the survival of 5/8 (62.5%) hamsters against lethal infection (P < 0.05). None of the control hamsters or animals immunized with the other vaccine preparations survived (Forster et al., 2013).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
113. Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4989.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0002295 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
114. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.20) |
a. Manufacturer: |
Wyeth, Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002321 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
115. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.21) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002322 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
116. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4BC5.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002323 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
117. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.01) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002277 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
118. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.20) |
a. Manufacturer: |
Pfizer, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002278 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
119. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002279 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
120. Parvovirus Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 48C5.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002280 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
121. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.01) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002292 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
122. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002293 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
123. Parvovirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4975.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002294 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
124. Parvovirus Modified Live Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 4960.00) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002291 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
125. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002309 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
126. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002310 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
127. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Bratislava-Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49F6.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002311 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
128. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002312 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
129. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002313 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
130. Parvovirus-Swine Influenza H1N1 & H3N2, Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 49G6.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002314 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
131. Porcine Reproductive & Respiratory Syndrome-Parvovirus Reproductive Form, Modified Live & Killed Virus Vaccine-Erysipelothrix Rhusiopathiae-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4P19.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002324 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
132. Trichomonas Foetus Vaccine, Killed Protozoa-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4990.00) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002296 |
c. Status: |
Licensed |
d. Location Licensed: |
USA |
e. Host Species for Licensed Use: |
Cattle |
|
|
|
|
|
|
|
|
IV. References |
1. Atzingen et al., 2012: Atzingen MV, Vieira ML, Oliveira R, Domingos RF, Mendes RS, Barros AT, Gonçales AP, de Morais ZM, Vasconcellos SA, Nascimento AL. Evaluation of immunoprotective activity of six leptospiral proteins in the hamster model of leptospirosis. The open microbiology journal. 2012; 6; 79-87. [PubMed: 23173023].
2. Conrad et al., 2017: Conrad NL, Cruz McBride FW, Souza JD, Silveira MM, Félix S, Mendonça KS, Santos CS, Athanazio DA, Medeiros MA, Reis MG, Dellagostin OA, McBride AJ. LigB subunit vaccine confers sterile immunity against challenge in the hamster model of leptospirosis. PLoS neglected tropical diseases. 2017; 11(3); e0005441. [PubMed: 28301479].
3. Evangelista et al., 2017: Evangelista KV, Lourdault K, Matsunaga J, Haake DA. Immunoprotective properties of recombinant LigA and LigB in a hamster model of acute leptospirosis. PloS one. 2017; 12(7); e0180004. [PubMed: 28704385].
4. Fernandes et al., 2017: Fernandes LGV, Teixeira AF, Filho AFS, Souza GO, Vasconcellos SA, Heinemann MB, Romero EC, Nascimento ALTO. Immune response and protective profile elicited by a multi-epitope chimeric protein derived from Leptospira interrogans. International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases. 2017; 57; 61-69. [PubMed: 28161462].
5. Forster et al., 2013: Forster KM, Hartwig DD, Seixas FK, Bacelo KL, Amaral M, Hartleben CP, Dellagostin OA. A Conserved Region of Leptospiral Immunoglobulin-Like A and B Proteins as a DNA Vaccine Elicits a Prophylactic Immune Response against Leptospirosis. Clinical and vaccine immunology : CVI. 2013; 20(5); 725-731. [PubMed: 23486420].
6. Humphryes et al., 2014: Humphryes PC, Weeks ME, AbuOun M, Thomson G, Núñez A, Coldham NG. Vaccination with leptospiral outer membrane lipoprotein LipL32 reduces kidney invasion of Leptospira interrogans serovar canicola in hamsters. Clinical and vaccine immunology : CVI. 2014; 21(4); 546-551. [PubMed: 24521782].
7. Lin et al., 2016: Lin X, Xiao G, Luo D, Kong L, Chen X, Sun D, Yan J. Chimeric epitope vaccine against Leptospira interrogans infection and induced specific immunity in guinea pigs. BMC microbiology. 2016; 16(1); 241. [PubMed: 27737644].
8. Maneewatch et al., 2007: Maneewatch S, Tapchaisri P, Sakolvaree Y, Klaysing B, Tongtawe P, Chaisri U, Songserm T, Wongratanacheewin S, Srimanote P, Chongsa-nguanz M, Chaicumpa W. OmpL1 DNA vaccine cross-protects against heterologous Leptospira spp. challenge. Asian Pacific journal of allergy and immunology / launched by the Allergy and Immunology Society of Thailand. 2007; 25(1); 75-82. [PubMed: 17891923].
9. Umthong et al., 2015: Umthong S, Buaklin A, Jacquet A, Sangjun N, Kerdkaew R, Patarakul K, Palaga T. Immunogenicity of a DNA and Recombinant Protein Vaccine Combining LipL32 and Loa22 for Leptospirosis Using Chitosan as a Delivery System. Journal of microbiology and biotechnology. 2015; 25(4); 526-536. [PubMed: 25348693].
10. Vijayachari et al., 2015: Vijayachari P, Vedhagiri K, Mallilankaraman K, Mathur PP, Sardesai NY, Weiner DB, Ugen KE, Muthumani K. Immunogenicity of a novel enhanced consensus DNA vaccine encoding the leptospiral protein LipL45. Human vaccines & immunotherapeutics. 2015; 11(8); 1945-1953. [PubMed: 26020621].
11. Wiki: Leptospirosis: Wiki: Leptospirosis [http://en.wikipedia.org/wiki/Leptospirosis]
|