Transmissible gastroenteritis virus |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- spike protein
(Protective antigen)
- Vaccine Information
- Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 19H1.20)
- Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21)
- Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49B1.21)
- Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49P1.20)
- Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 1961.20)
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
11149 |
|
2. Disease: |
| Porcine transmissible gastroenteritis |
|
3. Introduction |
| Transmissible gastroenteritis is an acute enteric disease of swine, most often fatal to newborn piglets. Its causative agent (TGEV) belongs to the Coronaviridae, a family of enveloped viruses with a large, single-stranded RNA of positive polarity as a genome. The virions are constructed from three major structural proteins: a phosphoprotein (N), which encapsidates the genomic RNA, an integral membrane protein (M or E 1 ) and a large glycoprotein (S or E2), which forms the viral projections (Laude et al., 1990). |
|
4. Microbial Pathogenesis |
| The pathology of TGEV is similar to that of other coronaviruses. Coronaviruses enter the host by first attaching to the host cell using the spike glycoprotein. The S protein interacts with the procine aminopeptidase N (pAPN), a cellular receptor, to aide in its entry. The same cell receptor is also a point of contact for Human Coronaviruses. A domain in the S spike protein is recognized by pAPN, and transfection of pAPN occurs to nonpermissive cells and infects them with TGEV. Once the virus infects the host, it multiplies in the cell lining of the small intestine resulting in the loss of absorptive cells that in turn leads to shortening of villi. The infected swine then has reduced capability for digesting food and die from dehydration (Wiki: Transmissible gastroenteritis coronavirus). |
|
5. Host Ranges and Animal Models |
| TGEV infects both pigs and humans. However, in young pigs, the mortality rate is close to 100% (Wiki: Transmissible gastroenteritis coronavirus). |
| II. Vaccine Related Pathogen Genes |
|
1. spike protein |
-
Gene Name :
spike protein
-
Sequence Strain (Species/Organism) :
Transmissible gastroenteritis virus
-
NCBI Protein GI :
AAF02707
-
Other Database IDs :
CDD:279880
-
Taxonomy ID :
11149
-
Protein Name :
spike protein
-
Protein pI :
6.48
-
Protein Weight :
31348.22
-
Protein Length :
378
-
Protein Note :
S
-
Protein Sequence : Show Sequence
>AAF02707.1 spike protein, partial [Transmissible gastroenteritis virus]
MKILFVVLVIMPLIYGDNFPCSKLTNRTIGKHWNLIDTFLINYSSRLPPNSDVVLGDYFPTVQPWFNCIP
NDSNDLYVTLENLKALYWDYATENITSNHRQRLNVVVNGYPYSITVTTTRNFNSAEGAIICICKGSPPTT
TTESSLTCNWGSECRLNHKFPICPSNSEANCGNMLYGLQWFADVVVAYLHGASYRISFENQWSGTVTLGD
MRATTSQTAGTLVDLWWFNPVYDVSYYRVNNKNGTTVVSNCTDQCASYVANVFVTQPGGFIPSDFSFNNW
FLLTNSSTLVSGKLVTKQP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Mou et al., 2016)
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 19H1.20) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002193 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Pig |
|
|
|
 |
|
 |
|
|
|
|
|
|
|
|
|
2. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002319 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49B1.21) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002307 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49P1.20) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002318 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Pig |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Transmissible Gastroenteritis Modified Live Virus Vaccine (USDA: 1961.20) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001811 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Pig |
|
|
|
|
|
|
|
|
| IV. References |
1. Mou et al., 2016: Mou C, Zhu L, Xing X, Lin J, Yang Q. Immune responses induced by recombinant Bacillus subtilis expressing the spike protein of transmissible gastroenteritis virus in pigs. Antiviral research. 2016; 131; 74-84. [PubMed: 26988122].
|
