Mannheimia haemolytica |
| Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- aroA
(Virmugen)
- Vaccine Information
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20)
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21)
- Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20)
- Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
- Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
- Mannheimia haemolytica aroA mutant vaccine
- Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01)
- References
|
| I. General Information |
| 1. NCBI Taxonomy ID: |
|
75985 |
|
2. Disease: |
| Bovine Respiratory Disease |
|
3. Introduction |
| Mannheimia haemolytica is the principal bacterium isolated from respiratory disease in feedlot cattle and is a significant component of enzootic pneumonia in all neonatal calves. A commensal of the nasopharynx, M. haemolytica is an opportunist, gaining access to the lungs when host defenses are compromised by stress or infection with respiratory viruses or mycoplasma (Rice et al., 2007). |
| II. Vaccine Related Pathogen Genes |
|
1. aroA |
-
Gene Name :
aroA
-
Sequence Strain (Species/Organism) :
M. haemolytica NADC-D60
-
NCBI Protein GI :
451485
-
Other Database IDs :
CDD:179423
CDD:30129
-
Taxonomy ID :
75985
-
Gene Strand (Orientation) :
?
-
Protein Name :
5-enolpyruvylshikimate 3-phosphate synthase
-
Protein Length :
434
-
Protein Note :
3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
-
Protein Sequence : Show Sequence
>gi|451485|gb|AAA21529.1| 5-enolpyruvylshikimate 3-phosphate synthase [Mannheimia haemolytica]
MEKLTLTPISRVEGEINLPGSKSLSNRALLLAALATGTTQVTNLLDSDDIRHMLNALKALGVKYELSDDK
TVCVLEGIGGAFKVQNGLSLFLGNAGTAMRPLAAALCLKGEEKSQIILTGEPRMKERPIKHLVDALRQVG
AEVQYLENEGYPPLAISNSVCRGGKVQIDGSISSQFLTALLMSAPLAEGDMEIEIIGDLVSKPYIDITLS
MMNDFGITVENRDYKTFLVKGKQGYVAPQGNYLVEGDASSASYFLASGAIKAGKVTGIGKKSIQGDRLFA
DVLEKMGAKITWGEDFIQAEQSPLKGVDMDMNHIPDAAMTIATTALFAEGETVIRNIYNWRVKETDRLTA
MATELRKVGAEVEEGEEGEDFIRIQPLALENFQHAEIETYNDHRMAMCFSLIALSNTEVTILDPNCTAKT
FPTYFRDLEKLSVR
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
An aroA mutant is highly attenuated in mice and induced significant protection after two doses from challenge with wild type M. haemolytica (Homchampa et al., 1994).
- Related Vaccine(s):
Mannheimia haemolytica aroA mutant vaccine
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.20) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001877 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
 |
|
 |
|
|
|
|
|
|
|
|
|
2. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45H5.21) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001878 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Bovine Rhinotracheitis Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 4109.20) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001879 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Bovine Rhinotracheitis-Parainfluenza 3 Killed Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin (USDA: 4265.00) |
| a. Manufacturer: |
| Boehringer Ingelheim Vetmedica, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001885 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001905 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001906 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001938 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001961 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002004 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002005 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20) |
| a. Manufacturer: |
| Boehringer Ingelheim Vetmedica, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002006 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21) |
| a. Manufacturer: |
| Boehringer Ingelheim Vetmedica, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002007 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002008 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20) |
| a. Manufacturer: |
| Texas Vet Lab, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002024 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Mannheimia haemolytica aroA mutant vaccine |
| a. Vaccine Ontology ID: |
| VO_0002856 |
| b. Type: |
| Live, attenuated vaccine |
| c. Status: |
| Research |
| d. Host Species as Laboratory Animal Model: |
| Mouse |
| e. Gene Engineering of
aroA |
|
| f. Immunization Route |
| Intraperitoneal injection (i.p.) |
| g.
Mouse Response |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Mannheimia Haemolytica-Pasteurella Multocida Avirulent Live Culture Vaccine (USDA: 1861.01) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002029 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cattle |
|
|
|
|
|
|
|
|
| IV. References |
1. Homchampa et al., 1994: Homchampa P, Strugnell RA, Adler B. Construction and vaccine potential of an aroA mutant of Pasteurella haemolytica. Veterinary microbiology. 1994; 42(1); 35-44. [PubMed: 7839583].
2. Rice et al., 2007: Rice JA, Carrasco-Medina L, Hodgins DC, Shewen PE. Mannheimia haemolytica and bovine respiratory disease. Animal health research reviews / Conference of Research Workers in Animal Diseases. 2007; 8(2); 117-128. [PubMed: 18218156].
|
