Bovine viral diarrhea virus 1 |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- E2 protein
(Protective antigen)
- Vaccine Information
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.30)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20)
- Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.22)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.23)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.26)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20)
- Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine (USDA: 1175.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.27)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.28)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C7.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44D5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44F9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21)
- Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11A5.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.30)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26)
- Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30)
- Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.00)
- Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.20)
- Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.21)
- Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.22)
- Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.25)
- Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21)
- Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20)
- Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21)
- Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25)
- Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.00)
- Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.20)
- Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.22)
- Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00)
- BVDV Inactivated Vaccine
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11099 |
2. Disease: |
Bovine viral Diarrhea (BVD) |
3. Introduction |
Bovine viral diarrhea (BVD) is most common in young cattle (6-24 mo old) and generally is accompanied by typical mucosal lesions; it must be distinguished from other viral diseases that produce diarrhea and mucosal lesions. Bovine viral diarrhea virus (BVDV), the causal agent of BVD and mucosal disease complex, is classified in the genus Pestivirus in the family Flaviviridae. Although cattle are the primary host for BVDV, several reports suggest most even-toed ungulates are also susceptible. Isolates of BVDV are separated into noncytopathic and cytopathic biotypes based on cytopathic effects observed in infected cell cultures. Noncytopathic BVDV are the predominant viral biotype in nature. Cytopathic BVDV are relatively rare and arise in cattle that are persistently infected with noncytopathic BVDV. The switch in viral biotype is triggered by mutations that often involve recombination of noncytopathic viral RNA with itself, with heterologous viral RNA, or with host cell RNA. Based on viral RNA sequence, there are at least 2 viral genotypes of BVDV that can be further divided into subgenotypes. The viral genotypes are termed BVDV type 1 and BVDV type 2, and both cytopathic and noncytopathic BVDV are represented in each viral genotype. Although the viral genotypes are antigenically related, serologic assays can separate BVDV type 1 from BVDV type 2. Serologic surveys indicate that BVDV is distributed worldwide. The prevalence of antiviral antibody in cattle varies among countries and may vary between geographic regions within a country. Prevalence of antiviral antibody may be >90% if vaccination is practiced commonly in a geographic region. Although cattle of all ages are susceptible, most cases of overt clinical disease are seen in cattle that are between 6 mo and 2 yr of age. Cattle that are persistently infected with noncytopathic BVDV serve as a natural reservoir for virus. Persistent infection develops when noncytopathic BVDV is transmitted transplacentally during the first 4 mo of fetal development. The calf is born infected with virus, remains infected for life, and usually is immunotolerant to the resident noncytopathic virus. Transplacental infection that occurs later in gestation results in abortion, congenital malformations, or birth of normal calves that have antibody against BVDV. The prevalence of persistent infection varies among countries and between regions within a country. In some areas, the prevalence of persistent infection in calves may be as high as 1-2% of cattle <1 yr of age. On a given farm, persistently infected cattle are often found in cohorts of animals that are approximately the same age. Persistently infected cattle can shed large amounts of BVDV in their secretions and excretions and readily transmit virus to susceptible herdmates. Clinical disease and reproductive failure often are seen after healthy cattle come in contact with a persistently infected animal. Biting insects, fomites, semen, biologic products, and possibly wild ruminants also can spread BVDV (Merck Vet Manual: Bovine Viral Diarrhea). |
II. Vaccine Related Pathogen Genes |
1. E2 protein |
-
Gene Name :
E2 protein
-
Sequence Strain (Species/Organism) :
Bovine viral diarrhea virus 1
-
NCBI Protein GI :
ABW24687
-
Other Database IDs :
CDD:292945
-
Taxonomy ID :
11099
-
Protein Name :
E2 protein
-
Protein pI :
4.52
-
Protein Weight :
12712.45
-
Protein Length :
177
-
Protein Note :
Pestivirus envelope glycoprotein E2; pfam16329
-
Protein Sequence : Show Sequence
>ABW24687.1 E2 protein, partial [Bovine viral diarrhea virus 1]
YPECKSEFSYAIAKDDKIGPLGAESLTTQWYEYTDGMKLEDTMVRVWCKDGEFRYFDKCTREDRYLAILH
TRALPTSVIFRKIASAQRLADIVEMDDSFEFGLCPCDAKP
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Mahony et al., 2015)
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.20) |
a. Manufacturer: |
Heska Corporation, Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001901 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine (USDA: 1155.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001902 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001903 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4145.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001904 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 43S5.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001905 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida-Salmonella Typhimurium Bacterin-Toxoid (USDA: 43T5.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001906 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4335.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001907 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Bovine Rhinotracheitis-Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4336.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001908 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001909 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation, Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001910 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.22) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001911 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001912 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine (USDA: 1151.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001913 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4141.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001914 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4339.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001915 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4359.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001916 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Hardjo-Pomona Bacterin (USDA: 4399.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001917 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001918 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001919 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Bovine Rhinotracheitis-Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4389.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001920 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine (USDA: 1175.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001921 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4435.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001922 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.00) |
a. Manufacturer: |
Wyeth, Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001923 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.20) |
a. Manufacturer: |
Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001924 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.22) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001925 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001926 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001927 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001928 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.27) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001929 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine (USDA: 1171.30) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001930 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.24) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001931 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4560.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001932 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Haemophilus Somnus-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4489.30) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001933 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001934 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
35. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4439.20) |
a. Manufacturer: |
Wyeth, Heska Corporation, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001935 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
36. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Grippotyphosa-Hardjo-Pomona Bacterin (USDA: 4479.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0001936 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
37. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3 Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4509.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001937 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
38. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Mannheimia Haemolytica Bacterin (USDA: 44A5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001938 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
39. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.00) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001939 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
40. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation, Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001940 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
41. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001941 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
42. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001942 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
43. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001943 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
44. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001944 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
45. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001945 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
46. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.26) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001946 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
47. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.28) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001947 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
48. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.30) |
a. Manufacturer: |
Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001948 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
49. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001949 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
50. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001950 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
51. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001951 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
52. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001952 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
53. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001953 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
54. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001954 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
55. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001955 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
56. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001956 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
57. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C7.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001957 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
58. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44D5.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001958 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
59. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001959 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
60. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D7.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001960 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
61. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica Bacterin (USDA: 4477.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001961 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
62. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001962 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
63. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001963 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
64. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4465.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001964 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
65. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001965 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
66. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4466.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001966 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
67. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona-Mannheimia Haemolytica Bacterin (USDA: 4475.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001967 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
68. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001968 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
69. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001969 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
70. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.22) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001970 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
71. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001971 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
72. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001972 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
73. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001973 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
74. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001974 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
75. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001975 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
76. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001976 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
77. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44F9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001977 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
78. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001978 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
79. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001979 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
80. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001980 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
81. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001981 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
82. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001982 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
83. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001983 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
84. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001984 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
85. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001985 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
86. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001986 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
87. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001987 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
88. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001988 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
89. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 44C9.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001989 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
90. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001990 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
91. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001991 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
92. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001992 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
93. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44D9.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001993 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
94. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.20) |
a. Manufacturer: |
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001994 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
95. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001995 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
96. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.22) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001996 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
97. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4461.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001997 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
98. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001998 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
99. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.01) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001999 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
100. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002000 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
101. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002001 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
102. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4469.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002002 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
103. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002003 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
104. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002004 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
105. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica Toxoid (USDA: 4X49.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002005 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
106. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002006 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
107. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 45B9.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002007 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
108. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002008 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
109. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11A5.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002009 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
110. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002010 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
111. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002011 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
112. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002012 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
113. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002013 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
114. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002014 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
115. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002015 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
116. Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001567 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
117. Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001568 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
118. Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001569 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
119. Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001570 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
120. Bovine Virus Diarrhea Killed Virus Vaccine (USDA: 1205.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001571 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
121. Bovine Virus Diarrhea Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 45B5.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002023 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
122. Bovine Virus Diarrhea Killed Virus Vaccine-Haemophilus Somnus-Mannheimia Haemolytica-Pasteurella Multocida Bacterin-Toxoid (USDA: 4C95.20) |
a. Manufacturer: |
Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0002024 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
123. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002025 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
124. Bovine Virus Diarrhea Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 4595.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002026 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
125. Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.00) |
a. Manufacturer: |
Colorado Serum Company, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001572 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
126. Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Heska Corporation, Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001573 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
127. Bovine Virus Diarrhea Modified Live Virus Vaccine (USDA: 1201.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001574 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
128. Bovine Virus Diarrhea Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4599.00) |
a. Manufacturer: |
Colorado Serum Company |
b. Vaccine Ontology ID: |
VO_0002027 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
129. BVDV Inactivated Vaccine |
a. Vaccine Ontology ID: |
VO_0004226 |
b. Type: |
Inactivated or "killed" vaccine |
c. Status: |
Research |
d. Antigen |
BVDV PT810 and BVDV 890 (Beer et al., 2000). |
e. Adjuvant: |
|
f. Immunization Route |
Intramuscular injection (i.m.) |
g.
Cattle Response |
- Host Strain:
Simmental
- Vaccination Protocol:
Twenty-one healthy cattle (“Simmental” breeds) seronegative to BVDV and BHV-1 and aged between 8 weeks and 7 months were used. Three groups (n=6) were vaccinated twice intramuscularly (i.m.) 28 days apart. Three calves were used as unvaccinated controls (Beer et al., 2000).
- Challenge Protocol:
Thirty-eight days after the second vaccination (p. vacc.), all animals were challenged intranasally with 106 TCID50 BVDV PT810 in 2 ml cell culture medium. Each animal was inoculated with the diluted virus suspension using an aerosol dispenser adapted to a MUTO™ syringe. One millilitre was applied per nostril (Beer et al., 2000).
- Efficacy:
Absence of viraemia (less than 10 TCID50/107 leukocytes) was observed in 50% of vaccinated calves (Beer et al., 2000).
|
|
|
|
 |
|
 |
|
|
IV. References |
1. Beer et al., 2000: Beer M, Hehnen HR, Wolfmeyer A, Poll G, Kaaden OR, Wolf G. A new inactivated BVDV genotype I and II vaccine. An immunisation and challenge study with BVDV genotype I. Veterinary microbiology. 2000; 77(1-2); 195-208. [PubMed: 11042413].
2. Mahony et al., 2015: Mahony D, Mody KT, Cavallaro AS, Hu Q, Mahony TJ, Qiao S, Mitter N. Immunisation of Sheep with Bovine Viral Diarrhoea Virus, E2 Protein Using a Freeze-Dried Hollow Silica Mesoporous Nanoparticle Formulation. PloS one. 2015; 10(11); e0141870. [PubMed: 26535891].
3. Merck Vet Manual: Bovine Viral Diarrhea: Merck Vet Manual: Bovine Viral Diarrhea and Mucosal Disease Complex [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/22103.htm]
|