Feline panleukopenia virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Host Protective Immunity
- Vaccine Related Pathogen Genes
- VP2
(Protective antigen)
- Vaccine Information
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
- Feline Panleukopenia Killed Virus Vaccine (USDA: 1565.20)
- Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.00)
- Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.20)
- Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.21)
- Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
10786 |
2. Disease: |
Feline Distemper |
3. Introduction |
Feline panleukopenia, commonly known as feline distemper, is a viral infection affecting cats, caused by feline parvovirus, a close relative of canine parvovirus. It is not related to canine distemper (Wiki: Feline Panleukopenia). Feline panleukopenia virus (FPV) is a non-enveloped virus which is resistant to physical factors and chemical substances. The virus can remain infectious for months outside of a host and is highly contagious (Truyen et al., 2009). |
4. Microbial Pathogenesis |
The virus primarily attacks the lining of the gastrointestinal tract, causing internal ulceration and, ultimately, total sloughing of the intestinal epithelium. This results in profuse and usually bloody diarrhea, severe dehydration, malnutrition, anemia, and often death. The virus causes a decrease in the cat's white blood cells, thus compromising its immune system. Typically, it also causes a decrease in hematocrit and platelet counts on a complete blood count (Wiki: Feline Panleukopenia). |
5. Host Ranges and Animal Models |
FPV can infect felids, raccoons, mink and foxes (Truyen et al., 2009). |
6. Host Protective Immunity |
Antibodies are critical in the immune response to FPV, and can protect kittens from fatal infection. Active immunity is solid and long lasting and can be achieved through the use of either inactivated or modified live virus vaccines (Truyen et al., 2009). |
II. Vaccine Related Pathogen Genes |
1. VP2 |
-
Gene Name :
VP2
-
Sequence Strain (Species/Organism) :
Feline panleukopenia virus
-
NCBI Protein GI :
CAA38911
-
Other Database IDs :
CDD:279128
GOA:P24840 InterPro: IPR001403 InterPro: IPR013607 InterPro: IPR016184 PDB: 1C8E PDB: 1C8F PDB: 1C8G PDB: 1FPV UniProtKB/UniProt: P24840
-
Taxonomy ID :
10786
-
Protein Name :
VP2
-
Protein pI :
5.45
-
Protein Weight :
61215.01
-
Protein Length :
639
-
Protein Note :
Parvovirus coat protein VP2; pfam00740
-
Protein Sequence : Show Sequence
>CAA38911.1 VP2 [Feline panleukopenia virus]
MSDGAVQPDGGQPAVRNERATGSGNGSGGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVH
LNMPESENYKRVVVNNMDKTAVKGNMALDDIHVQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVS
FEQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPWKPTIPTPWRY
YFQWDRTLIPSHTGTSGTPTNVYHGTDPDDVQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLTHTWQ
TNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMGNTDYITEATIMRPAEVGYSAPYYSFEASTQ
GPFKTPIAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQNINF
NLPVTNDNVLLPTDPIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVC
QNNCPGQLFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFN
YVPNNIGAMKIVYEKSQLAPRKLY
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Yang et al., 2008)
|
III. Vaccine Information |
|
|
|
|
|
|
1. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001843 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001844 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001845 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001846 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001847 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001848 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001849 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001850 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Feline Panleukopenia Killed Virus Vaccine (USDA: 1565.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001550 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.00) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001551 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.20) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001552 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001553 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Feline Panleukopenia Modified Live Virus Vaccine (USDA: 1561.23) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001554 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001853 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001854 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001855 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001856 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001857 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001858 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001859 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001860 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001861 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001862 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001863 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001864 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001865 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001866 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001867 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001868 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001869 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001870 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001871 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
|
|
|
|
|
IV. References |
1. Truyen et al., 2009: Truyen U, Addie D, Belák S, Boucraut-Baralon C, Egberink H, Frymus T, Gruffydd-Jones T, Hartmann K, Hosie MJ, Lloret A, Lutz H, Marsilio F, Pennisi MG, Radford AD, Thiry E, Horzinek MC. Feline panleukopenia. ABCD guidelines on prevention and management. Journal of feline medicine and surgery. 2009; 11(7); 538-546. [PubMed: 19481033].
2. Wiki: Feline Panleukopenia: Wiki: Feline Panleukopenia [http://en.wikipedia.org/wiki/Feline_Panleukopenia]
3. Yang et al., 2008: Yang S, Xia X, Qiao J, Liu Q, Chang S, Xie Z, Ju H, Zou X, Gao Y. Complete protection of cats against feline panleukopenia virus challenge by a recombinant canine adenovirus type 2 expressing VP2 from FPV. Vaccine. 2008; 26(11); 1482-1487. [PubMed: 18313810].
|