Feline calicivirus |
Table of Contents
|
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Host Protective Immunity
- Vaccine Related Pathogen Genes
- F9
(Protective antigen)
- Vaccine Information
- Feline Calicivirus Killed Virus Vaccine (USDA: 15C5.21)
- Feline Calicivirus Modified Live Virus Vaccine (USDA: 15C1.22)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
- Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
- Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20)
- Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20)
- Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21)
- Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22)
- Myxoma-FCV
- References
|
I. General Information
|
|
II. Vaccine Related Pathogen Genes |
1. F9 |
-
Gene Name :
F9
-
Sequence Strain (Species/Organism) :
Feline calicivirus
-
NCBI Protein GI :
AAB23553
-
Other Database IDs :
CDD:279283
-
Taxonomy ID :
11978
-
Protein Name :
capsid protein
-
Protein pI :
6.04
-
Protein Weight :
47605.82
-
Protein Length :
573
-
Protein Note :
Calicivirus coat protein; pfam00915
-
Protein Sequence : Show Sequence
>AAB23553.1 capsid protein {C-terminal} [feline calicivirus FCV, F9, vaccine strain, Peptide Partial, 455 aa]
VRFSISGSGVFGGKLAAIVVPPGVDPVQSTSMLQYPHVLFDARQVEPVIFSIPDLRSTLYHLMSDTDTTS
LVIMVYNDLINPYANDANSSGCIVTVETKPGPDFKFHLLKPPGSMLTHGSVPSDLIPKTSSLWIGNRYWS
DITDFVIRPFVFQANRHFDFNQETAGWSTPRFRPISVTISEQNGAKLGIGVATDYIAPGIPDGWPDTTIP
GELIPAGDYAITNGTGNDITTATGYDTADIIKNNTNFRGMYICGSLQRAWGDKKISNTAFITTATLDGDN
NNKINPCNTIDQSKIVVFQDNHVGKEVQTSDDTLALLGYTGIGEQAIGSDRDRVVRISTLPETGARGGNH
PIFYKNSIKLGYVIRSIDVFNSQILHTSRQLSLNHYLLPPDSFAVYRIIDSNGSWFDIGIDSDGFSFVGV
SGFGKLEFPLSASYMGIQLAKIRLASNIRSPMTKL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(McCabe and Spibey, 2005)
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Feline Calicivirus Killed Virus Vaccine (USDA: 15C5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001540 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Feline Calicivirus Modified Live Virus Vaccine (USDA: 15C1.22) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001541 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001843 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001844 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001845 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001846 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001847 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001848 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001849 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001850 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001851 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001852 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001853 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Feline Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 16D5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001854 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 16D9.20) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001855 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001856 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001857 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.23) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001858 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001859 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001860 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Feline Rhinotracheitis-Calici-Panleukopenia Modified Live Virus Vaccine (USDA: 16D8.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001861 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001862 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001863 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001864 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001865 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001866 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001867 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001868 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001869 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live & Killed Virus Vaccine (USDA: 16T9.20) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001870 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Feline Rhinotracheitis-Calici-Panleukopenia-Rabies Modified Live Virus, Canarypox Vector Vaccine (USDA: 16T9.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001871 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Pfizer, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001872 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.21) |
a. Manufacturer: |
Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001873 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Feline Rhinotracheitis-Calicivirus Modified Live Virus Vaccine (USDA: 16C1.22) |
a. Manufacturer: |
Wyeth, Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001874 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
35. Myxoma-FCV |
a. Vaccine Ontology ID: |
VO_0004707 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Baboon |
e. Immunization Route |
Intramuscular injection (i.m.) |
f.
Cat Response |
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
Cats immunised with myxoma-FCV recombinant virus generated high levels of serum neutralising antibody (McCabe et al., 2002).
- Efficacy:
Cats immunised with myxoma-FCV recombinant virus were protected from disease on subsequent challenge with virulent FCV (McCabe et al., 2002).
|
|
|
|
 |
|
 |
|
|
IV. References |
1. McCabe and Spibey, 2005: McCabe VJ, Spibey N. Potential for broad-spectrum protection against feline calicivirus using an attenuated myxoma virus expressing a chimeric FCV capsid protein. Vaccine. 2005; 23(46-47); 5380-5388. [PubMed: 16176851].
2. McCabe et al., 2002: McCabe VJ, Tarpey I, Spibey N. Vaccination of cats with an attenuated recombinant myxoma virus expressing feline calicivirus capsid protein. Vaccine. 2002; 20(19-20); 2454-2462. [PubMed: 12057600].
3. Radford et al., 2007: Radford AD, Coyne KP, Dawson S, Porter CJ, Gaskell RM. Feline calicivirus. Veterinary research. 2007; 38(2); 319-335. [PubMed: 17296159].
|