1. NCBI Taxonomy ID: |
11021 |
2. Disease: |
Encephalitis |
3. Introduction |
Eastern equine encephalitis virus (EEE), commonly called sleeping sickness (not to be confused with Trypanosomiasis) or Triple E, is a zoonotic alphavirus and arbovirus present in North, Central and South America and the Caribbean. EEE was first recognized in Massachusetts, USA in 1831 when 75 horses died of encephalitic illness. Epizootics in horses have continued to occur regularly in the United States. EEE is found today in the eastern part of the country and is often associated with coastal plains (Wiki: Eastern Equine Encephalitis). |
4. Host Ranges and Animal Models |
EEE is capable of infecting a wide range of animals including mammals, birds, reptiles and amphibians. The virus is maintained in nature through a bird - mosquito cycle. There are two mosquito species primarily involved in this portion of the cycle, they are Culiseta melanura and Cs. morsitans. These mosquitoes feed on the blood of birds. The amount of virus found in nature increases throughout the summer as more birds and more mosquitoes become infected. Transmission of EEEV to mammals occurs via other mosquitoes. These other mosquitoes are called bridge vectors because they bring the virus from avian populations to mammalian populations. They include Coquiletidia perturbans, Aedes vexans, Ochlerotatus sollicitans and Oc. canadensis. All these mosquitoes are primarily mammalian feeders (Wiki: Eastern Equine Encephalitis). |
II. Vaccine Related Pathogen Genes |
1. C protein |
-
Gene Name :
C protein
-
Sequence Strain (Species/Organism) :
Eastern Equine Encephalitis Virus
-
NCBI Protein GI :
NP_740644
-
Other Database IDs :
CDD:279312
-
Taxonomy ID :
11021
-
Protein Name :
C protein
-
Protein pI :
10.89
-
Protein Weight :
27918.15
-
Protein Length :
324
-
Protein Note :
Alphavirus core protein; pfam00944
-
Protein Sequence : Show Sequence
>NP_740644.1 C protein [Eastern equine encephalitis virus]
MFPYPTLNYPPMAPINPMAYRDPNPPRRRWRPFRPPLAAQIEDLRRSIANLTLKQRAPNPPAGPPAKRKK
PAPSLSLRRKKKRPPPPAKKQKRKPKPGKRQRMCMKLESDKTFPIMLNGQVNGYACVVGGRVFKPLHVEG
RIDNEQLAAIKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRFTVPRGVGGKGD
SGRPILDNKGRVVAIVLGGVNEGSRTALSVVTWNQKGVTVKDTPEGSEPW
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ma et al., 2014)
|
2. E1 protein |
-
Gene Name :
E1 protein
-
Sequence Strain (Species/Organism) :
Eastern Equine Encephalitis Virus
-
NCBI Protein GI :
NP_740648
-
Other Database IDs :
CDD:279870
-
Taxonomy ID :
11021
-
Protein Name :
E1 protein
-
Protein pI :
6.77
-
Protein Weight :
44561.35
-
Protein Length :
509
-
Protein Note :
Alphavirus E1 glycoprotein; pfam01589
-
Protein Sequence : Show Sequence
>NP_740648.1 E1 protein [Eastern equine encephalitis virus]
YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTS
KPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSV
SWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVVHGHEVYNYDFPEYGTGKAGSFGDLQSRTST
SNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPIS
IDIPDAAFTRISETPTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAES
GSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA
FIVLGLIATAVVALVLFFHRH
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ma et al., 2014)
|
3. E2 protein |
-
Gene Name :
E2 protein
-
Sequence Strain (Species/Organism) :
Eastern Equine Encephalitis Virus
-
NCBI Protein GI :
AAL09089
-
Other Database IDs :
CDD:279311
-
Taxonomy ID :
11021
-
Protein Name :
E2 protein
-
Protein pI :
8.04
-
Protein Weight :
4443.92
-
Protein Length :
110
-
Protein Note :
collected in 1992
-
Protein Sequence : Show Sequence
>AAL09089.1 E2 protein, partial [Eastern equine encephalitis virus]
AIIMVSCVTSVWLLCRTRNLCITPYRLAPNAQVPILLAVL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ma et al., 2014)
|
4. E3 protein |
-
Gene Name :
E3 protein
-
Sequence Strain (Species/Organism) :
Eastern Equine Encephalitis Virus
-
NCBI Protein GI :
NP_740645
-
Other Database IDs :
CDD:279849
-
Taxonomy ID :
11021
-
Protein Name :
E3 protein
-
Protein pI :
4.93
-
Protein Weight :
7382.68
-
Protein Length :
125
-
Protein Note :
Alphavirus E3 glycoprotein; pfam01563
-
Protein Sequence : Show Sequence
>NP_740645.1 E3 protein [Eastern equine encephalitis virus]
SLATVMCVLANITFPCDQPPCMPCCYEKNPHETLTMLEQNYDSRAYDQLLDAAVKCNARRTRR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ma et al., 2014)
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Eastern Equine Encephalitis Virus Vaccine SIN/NAEEEV |
a. Type: |
Live, attenuated vaccine |
b. Status: |
Research |
c. Host Species for Licensed Use: |
None |
d. Antigen |
Genetic backbone and nonstructural protein genes from Sindbis virus (SINV), Structural protein genes from a North American (SIN/NAEEEV) strain of EEEV. (Roy et al., 2013) |
e. Immunization Route |
subcutaneous injection |
f. Description |
A chimeric Sindbis-based vaccine protects cynomolgus macaques against a lethal aerosol challenge of eastern equine encephalitis virus. (Roy et al., 2013) |
g.
Macaque Response |
- Vaccination Protocol:
In the first study, animals were vaccinated with SIN/NAEEEV (n=6), SIN/SAEEEV (n=6), or PBS diluent (n=4). In the second study, cohorts were vaccinated with either SIN/NAEEEV (n=5) or PBS (n=2). All animals were vaccinated subcutaneously (SC) in the upper deltoid with a single inoculation of either saline or 5.0 log10 PFU of vaccine a volume of 100 μl. (Roy et al., 2013)
- Immune Response:
Five of 6 macaques (83%) vaccinated with SIN/NAEEEV in the first study developed of neutralizing antibodies (Abs), first detected on day 12 post vaccination. Neutralizing Abs remained at initial levels or decreased slightly in the majority of the animals by day 24 or 45 post vaccination. Antibody responses in vaccinated animals from the second experiment, assayed on day 66 after vaccination, were slightly lower on average. (Roy et al., 2013)
- Challenge Protocol:
On either day 45 (study 1) or 66 (study 2) after vaccination, anesthetized macaques were challenged with virulent EEEV strain FL93-939 aerosols using a 16 liter head-only dynamic inhalation exposure system. (Roy et al., 2013)
- Efficacy:
The SIN/NAEEEV vaccine provided highly significant (p=0.0023) protection from fatal disease (figure 1), with 9 of the 11 animals (82%) surviving for 21 days until the study was terminated. Animals receiving the SIN/SAEEEV were not significantly protected, with only one of the six (17%) surviving challenge. All (6/6) animals in the sham-vaccinated cohort died from encephalitis. Protected animals exhibited minimal changes in temperature and cardiovascular rhythm, whereas unprotected animals showed profound hyperthermia and changes in heart rate post-exposure. Acute inflammation and neuronal necrosis were consistent with EEEV-induced encephalitis in unprotected animals, whereas no encephalitis-related histopathologic changes were observed in the SIN/NAEEEV-vaccinated animals. (Roy et al., 2013)
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002266 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.27) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002268 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002269 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002270 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Encephalomyelitis Eastern & Western, Killed Virus Vaccine (USDA: 1475.00) |
a. Manufacturer: |
Intervet Inc., Colorado Serum Company, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002116 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.00) |
a. Manufacturer: |
Colorado Serum Company, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002263 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.01) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002264 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002265 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.26) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002267 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002271 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002272 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A0) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002273 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A1) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002274 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002248 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002249 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002250 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.45) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002251 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.46) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002252 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 13W5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002115 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 46W5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002238 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Encephalomyelitis-Rhinopneumonitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4844.30) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002253 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002258 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002259 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002260 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.32) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002261 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002254 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002255 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.32) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002256 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.33) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002257 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Encephalomyelitis-Rhinopneumonitis-Influenza-West Nile Virus Eastern & Western, Killed Virus, Killed Flavivirus Chimera Vaccine-Tetanus Toxoid (USDA: 4855.R2) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002262 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine (USDA: 14W5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002128 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002284 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002287 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
35. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 14W5.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002127 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
36. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002285 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
37. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002286 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
38. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine (USDA: 14W7.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002129 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
39. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine-Tetanus Toxoid (USDA: 48W9.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002288 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
 |
|
 |
|
|
IV. References |
1. Ma et al., 2014: Ma J, Wang H, Zheng X, Xue X, Wang B, Wu H, Zhang K, Fan S, Wang T, Li N, Zhao Y, Gao Y, Yang S, Xia X. CpG/Poly (I:C) mixed adjuvant priming enhances the immunogenicity of a DNA vaccine against eastern equine encephalitis virus in mice. International immunopharmacology. 2014; 19(1); 74-80. [PubMed: 24440303].
2. Wiki: Eastern Equine Encephalitis: Wiki: Eastern Equine Encephalitis Virus [http://en.wikipedia.org/wiki/Eastern_equine_encephalitis_virus]
|