Infectious Bursal Disease Virus (IBDV) |
Table of Contents
|
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Host Protective Immunity
- Vaccine Related Pathogen Genes
- VP2
(Protective antigen)
- VP2, VP3, and VP4
(Protective antigen)
- VP2-VP4-VP3
(Protective antigen)
- Vaccine Information
- Bursal Disease Killed Virus Vaccine (USDA: 1275.00)
- Bursal Disease Killed Virus Vaccine (USDA: 1275.02)
- Bursal Disease Killed Virus Vaccine (USDA: 1275.20)
- Bursal Disease Live Virus Vaccine (USDA: 1271.00)
- Bursal Disease Live Virus Vaccine (USDA: 1271.01)
- Bursal Disease Live Virus Vaccine (USDA: 1271.02)
- Bursal Disease Live Virus Vaccine (USDA: 1271.04)
- Bursal Disease Live Virus Vaccine (USDA: 1271.0A)
- Bursal Disease Live Virus Vaccine (USDA: 1271.10)
- Bursal Disease Live Virus Vaccine (USDA: 1271.11)
- Bursal Disease Live Virus Vaccine (USDA: 1271.12)
- Bursal Disease Live Virus Vaccine (USDA: 1271.13)
- Bursal Disease Live Virus Vaccine (USDA: 1271.16)
- Bursal Disease Live Virus Vaccine (USDA: 1271.17)
- Bursal Disease Live Virus Vaccine (USDA: 1271.18)
- Bursal Disease Live Virus Vaccine (USDA: 1271.19)
- Bursal Disease Live Virus Vaccine (USDA: 1271.40)
- Bursal Disease Live Virus Vaccine (USDA: 1271.41)
- Bursal Disease Live Virus Vaccine (USDA: 1272.00)
- Bursal Disease Modified Live VirusVaccine (USDA: 1271.15)
- Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.01)
- Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.40)
- Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.41)
- Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.4A)
- Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.00)
- Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.01)
- Bursal Disease Variant, Killed Virus Vaccine (USDA: 12A5.00)
- Bursal Disease Variant, Live Virus Vaccine (USDA: 12L1.00)
- Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A)
- Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50)
- Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0)
- Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0)
- Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1)
- Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2)
- Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40)
- Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43)
- Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42)
- Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44)
- Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52)
- Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50)
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: )
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50)
- Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51)
- Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.10)
- Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.11)
- Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.43)
- Bursal Disease-Newcastle Disease Standard & Variant, Killed Virus Vaccine (USDA: 12G5.42)
- Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M)
- Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62)
- Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45)
- Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0)
- Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40)
- Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41)
- Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0)
- Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1)
- Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0)
- BV-Dual-S1
- fp-IBD1
- FP-IBDV-VP2
- IBDV DNA vaccine pCAGoptiVP2/rVP2
- IBDV DNA vaccine pCAGVP243-IL-18
- Infectious Bursal Disease Virus DNA Vaccine expressing VP2
- rFPV-IBDV-VP 2.4.3
- rFPV-IBDV-VP2
- rMDV-IBDV-VP2
- References
|
I. General Information
|
|
|
|
II. Vaccine Related Pathogen Genes |
|
1. VP2 |
|
|
2. VP2, VP3, and VP4 |
-
Gene Name :
VP2, VP3, and VP4
-
Sequence Strain (Species/Organism) :
Infectious Bursal Disease Virus (IBDV)
-
NCBI Protein GI :
AAA52086
-
Other Database IDs :
CDD:280020
CDD:280022 CDD:280021
-
Taxonomy ID :
10995
-
Protein Name :
VP2
-
Protein pI :
6.23
-
Protein Weight :
103255.8
-
Protein Length :
1092
-
Protein Note :
Birnavirus VP2 protein; pfam01766
-
Protein Sequence : Show Sequence
>AAA52086.1 VP2, VP3, and VP4 [Infectious bursal disease virus]
MTNLQDQTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGA
HYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVS
YNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITA
ADDYQFSSQYQTGGVTITLFSANIDAITSLSVGGELVFKTSVHSLVLGATIYLIGFDGSAVITRAVAANN
GLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQEGDQMSWSASGSLAVTIHGGNYPGALRPVT
LVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYT
DFREYFMEVADLSSPLKIAGAFGFKDIIRAIRRIAVPVVSTLFPPAAPLAHAIGEGVDYLLGDEAQAASG
TARAASGKARAASGRIRQLTLAADKGYEVVANLFQVPQNPVVDGILASPGILRGAHNLDCVLREGATLFP
VVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPDGVLPLETGRDYTVVPI
DDVWDDSIMLSKDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNACGEIEKISFRSTKLATAHRLG
LKLAGPGAFDVNTGPNWATFIKRFPHNPRDWDRLPYLNLPYLPPNAGRQYHLAMAASEFKETPELESAVR
AMEAAASVDPLFQSALSVFMWLEENGIVTDMANFALSDPNAHRMRNFLANAPQAGSKSQRAKYGTAGYGV
EARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHA
EKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKHRNPRRA
PPKPKPRPNAPTQRPPGRLGRWIRTVSDEDLE
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Ge et al., 2015)
|
|
3. VP2-VP4-VP3 |
-
Gene Name :
VP2-VP4-VP3
-
Sequence Strain (Species/Organism) :
Infectious bursal disease virus strain 3529/92 serotype 1
-
NCBI Protein GI :
452029936
-
Other Database IDs :
CDD:280020
CDD:280022 CDD:280021
-
Taxonomy ID :
10995
-
Gene Strand (Orientation) :
?
-
Protein Name :
polyprotein
-
Protein pI :
5.6
-
Protein Weight :
102895.25
-
Protein Length :
1086
-
Protein Note :
subtype: vvIBDV
-
Protein Sequence : Show Sequence
>AGF91988.1 polyprotein [Infectious bursal disease virus]
MTNLQDQTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGA
HYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVS
YNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITA
ADDYQFSSQYQAGGVTITLFSANIDAITSLSIGGELVFQTSVQGLILGATIYLIGFDGTAVITRAVAADN
GLTAGTDNLMPFNIVIPTSEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVT
LVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYT
DFREYFMEVADLNSPLKIAGAFGFKDIIRALRRIAVPVVSTLFPPAAPLAHAIGEGVDYLLGDEAQAASG
TARAASGKARAASGRIRQLTLAADKGYEVVANLFQVPQNPVVDGILASPGILRGAHNLDCVLREGATLFP
VVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPDGVLPLETGRDYTVVPI
DDVWDDSIMLSNDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNAYGEIENVSFRSTKLATAHRLG
LKLAGPGAFDVNTGSNWATFIKRFPHNPRDWDRLPYLNLPYLPPNAGRQYDLAMAASEFKETPELESAVR
AMEAAANVDPLFQSALSVFMWLEENGIVTDMANFALSDPNAHRMRNFLANAPQAGSKSQRAKYGTAGYGV
EARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHA
EKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKHRNPRRA
PPKPKPKPNVPTQRPPGRLGRWIRAVSDEDLE
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
IBDV DNA vaccine pCAGVP243-IL-18
,
rFPV-IBDV-VP 2.4.3
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. Bursal Disease Killed Virus Vaccine (USDA: 1275.00) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001632 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
2. Bursal Disease Killed Virus Vaccine (USDA: 1275.02) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001633 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
3. Bursal Disease Killed Virus Vaccine (USDA: 1275.20) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001634 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
4. Bursal Disease Live Virus Vaccine (USDA: 1271.00) |
| a. Manufacturer: |
| Wyeth, Intervet Inc., Lohmann Animal Health International, Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001635 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
5. Bursal Disease Live Virus Vaccine (USDA: 1271.01) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0001636 |
| c. Status: |
| Licensed |
| d. Location Licensed: |
| USA |
| e. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
6. Bursal Disease Live Virus Vaccine (USDA: 1271.02) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001637 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
7. Bursal Disease Live Virus Vaccine (USDA: 1271.04) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0001638 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
8. Bursal Disease Live Virus Vaccine (USDA: 1271.0A) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001639 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
9. Bursal Disease Live Virus Vaccine (USDA: 1271.10) |
| a. Manufacturer: |
| Wyeth, Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001640 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
10. Bursal Disease Live Virus Vaccine (USDA: 1271.11) |
| a. Manufacturer: |
| Intervet Inc., Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001641 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
11. Bursal Disease Live Virus Vaccine (USDA: 1271.12) |
| a. Manufacturer: |
| Intervet Inc., Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001642 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
12. Bursal Disease Live Virus Vaccine (USDA: 1271.13) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001643 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
13. Bursal Disease Live Virus Vaccine (USDA: 1271.16) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001644 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
14. Bursal Disease Live Virus Vaccine (USDA: 1271.17) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001645 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
15. Bursal Disease Live Virus Vaccine (USDA: 1271.18) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001646 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
16. Bursal Disease Live Virus Vaccine (USDA: 1271.19) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001647 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
17. Bursal Disease Live Virus Vaccine (USDA: 1271.40) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001648 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
18. Bursal Disease Live Virus Vaccine (USDA: 1271.41) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001649 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
19. Bursal Disease Live Virus Vaccine (USDA: 1272.00) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001650 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
20. Bursal Disease Modified Live VirusVaccine (USDA: 1271.15) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001651 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
21. Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.01) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001652 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
22. Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.40) |
| a. Manufacturer: |
| Merial, Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0001653 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
23. Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.41) |
| a. Manufacturer: |
| Intervet Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0001654 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
24. Bursal Disease Standard & Variant, Killed Virus Vaccine (USDA: 12B5.4A) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0001655 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
25. Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.00) |
| a. Manufacturer: |
| Intervet Inc., Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001656 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
26. Bursal Disease Standard & Variant, Live Virus Vaccine (USDA: 12B1.01) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001657 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
27. Bursal Disease Variant, Killed Virus Vaccine (USDA: 12A5.00) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001658 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
28. Bursal Disease Variant, Live Virus Vaccine (USDA: 12L1.00) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001659 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
29. Bursal Disease-Marek's Disease Serotype 3, Live Marek's Disease Vector Vaccine (USDA: 1A88.R0) |
| a. Manufacturer: |
| Merial, Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002197 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
30. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.42) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002043 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
31. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1288.4A) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002047 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
32. Bursal Disease-Marek's Disease Serotype 3, Live Virus Vaccine (USDA: 1A82.50) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002196 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
33. Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002040 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
34. Bursal Disease-Marek's Disease Serotypes 1 & 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R0) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002040 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
35. Bursal Disease-Marek's Disease Serotypes 1 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1281.R1) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002041 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
36. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.43) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002044 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
37. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.44) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002045 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
38. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1288.45) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002046 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
39. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus Vaccine (USDA: 1B82.50) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002200 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
40. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R1) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002198 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
41. Bursal Disease-Marek's Disease Serotypes 2 & 3, Live Virus, Live Marek's Disease Vector Vaccine (USDA: 1A88.R2) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002199 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
42. Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.40) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002051 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
43. Bursal Disease-Marek's Disease Standard & Variant, Serotype 3, Live Virus Vaccine (USDA: 12C8.43) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002053 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
44. Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.42) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002052 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
45. Bursal Disease-Marek's Disease Standard & Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C8.44) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002054 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
46. Bursal Disease-Marek's Disease Variant Strain, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.52) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002050 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
47. Bursal Disease-Marek's Disease Variant, Serotype 3, Live Virus Vaccine (USDA: 1282.50) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002042 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
48. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: ) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002031 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
49. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.50) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002048 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
50. Bursal Disease-Marek's Disease Variant, Serotypes 2 & 3, Live Virus Vaccine (USDA: 12C2.51) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002049 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
51. Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.10) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002065 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
52. Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.11) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002066 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
53. Bursal Disease-Newcastle Disease Killed Virus Vaccine (USDA: 12G5.43) |
| a. Manufacturer: |
| Lohmann Animal Health International, Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002068 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
54. Bursal Disease-Newcastle Disease Standard & Variant, Killed Virus Vaccine (USDA: 12G5.42) |
| a. Manufacturer: |
| Intervet Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002067 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
55. Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002069 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
56. Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002070 |
| c. Type: |
| Live vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
57. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002071 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
58. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002072 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
59. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002074 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
60. Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45) |
| a. Manufacturer: |
| Lohmann Animal Health International, Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002060 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
61. Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61) |
| a. Manufacturer: |
| Intervet Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002073 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
62. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00) |
| a. Manufacturer: |
| Lohmann Animal Health International, Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002075 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
63. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01) |
| a. Manufacturer: |
| Intervet Inc., Lohmann Animal Health International, Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002076 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
64. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002078 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
65. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002077 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
66. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002081 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
67. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002082 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
68. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90) |
| a. Manufacturer: |
| Wyeth, Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002083 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
69. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91) |
| a. Manufacturer: |
| Wyeth, Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002084 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
70. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41) |
| a. Manufacturer: |
| Lohmann Animal Health International, Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002079 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
71. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002080 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
72. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002085 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
73. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0002086 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
74. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41) |
| a. Manufacturer: |
| Intervet Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002087 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
75. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002088 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
76. Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002056 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
77. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01) |
| a. Manufacturer: |
| Merial, Inc., Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002055 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
78. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002057 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
79. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04) |
| a. Manufacturer: |
| Lohmann Animal Health International |
| b. Vaccine Ontology ID: |
| VO_0002058 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
80. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002059 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
81. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0) |
| a. Manufacturer: |
| Biomune Company |
| b. Vaccine Ontology ID: |
| VO_0002061 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
82. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002062 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
83. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0002063 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
84. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0002064 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
85. BV-Dual-S1 |
| a. Vaccine Ontology ID: |
| VO_0004652 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Immunization Route |
| Intramuscular injection (i.m.) |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
86. fp-IBD1 |
| a. Vaccine Ontology ID: |
| VO_0004622 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Licensed |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Immunization Route |
| Intramuscular injection (i.m.) |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
87. FP-IBDV-VP2 |
| a. Vaccine Ontology ID: |
| VO_0004742 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Gene Engineering of
VP2 |
- Type:
Recombinant vector construction
- Description:
A fowlpox virus vector was used to carry the VP2 gene of infectious bursal disease virus (IBDV) fused with β-galactosidase (Butter et al., 2013).
- Detailed Gene Information: Click here.
|
| f. Preparation |
| (Butter et al., 2013) fp-IBD1, which consists of a fowlpox virus vector carrying the VP2 gene of infectious bursal disease virus (IBDV) fused with β-galactosidase. |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
88. IBDV DNA vaccine pCAGoptiVP2/rVP2 |
| a. Vaccine Ontology ID: |
| VO_0004533 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Host Species as Laboratory Animal Model: |
| Chickens |
| e. Gene Engineering of
VP2 |
- Type:
DNA vaccine construction
- Description:
The synthetic gene for VP2 protein of vvIBDV Gx with codons optimized for chicken usage was synthesized and cloned into pCAGGS vector (Gao et al., 2013).
- Detailed Gene Information: Click here.
|
| f. Vector: |
| pCAGGS prime, rVP2 protein boost (Gao et al., 2013) |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Chicken Response |
- Immune Response:
Chickens in the DNA prime–protein boost group developed significantly higher levels of ELISA and neutralizing antibodies to IBDV compared with those immunized with either the DNA vaccine or the protein vaccine alone (P < 0.05). Furthermore, the highest levels of lymphocyte proliferation response, IL-4 and IFN-γ production were induced following priming with the DNA vaccine and boosting with the rVP2 protein (Gao et al., 2013).
- Efficacy:
Chickens inoculated with the DNA prime–protein boost vaccine had 100% protection against challenge with vvIBDV, as evidenced by the absence of clinical signs, mortality, and bursal atrophy. In contrast, chickens receiving the DNA vaccine and the rVP2 protein vaccine had 67% and 80% protection, respectively (Gao et al., 2013).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
89. IBDV DNA vaccine pCAGVP243-IL-18 |
| a. Vaccine Ontology ID: |
| VO_0004534 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Host Species as Laboratory Animal Model: |
| Chickens |
| e. Antigen |
| VP243 gene of vvIBDV HLJ0504 (VP243 can be cleaved into VP2, VP3, and VP4) (Li et al., 2013) |
| f. Gene Engineering of
VP2-VP4-VP3 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
| g. Vector: |
| pCAGGS (Li et al., 2013) |
| h. Immunization Route |
| Intramuscular injection (i.m.) |
| i.
Chicken Response |
- Immune Response:
Chickens immunized with plasmid pCAGVP243-IL-18 carrying both VP243 and IL-18 genes induced significantly higher levels of antibodies, lymphocyte proliferation responses and of the cytokines IL-4 and IFN-γ than those injected with pCAGVP243 encoding the VP243 gene alone (Li et al., 2013).
- Efficacy:
Furthermore, pCAGVP243-IL-18 provided higher protection (93%) against vvIBDV challenge in chickens than pCAGVP243 (60%), as evidenced by the absence of clinical signs, mortality, and bursal atrophy (Li et al., 2013).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
90. Infectious Bursal Disease Virus DNA Vaccine expressing VP2 |
| a. Vaccine Ontology ID: |
| VO_0004585 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Gene Engineering of
VP2 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
| e. Vector: |
| pIRES (Kumar et al., 2009) |
| f. Immunization Route |
| Intramuscular injection (i.m.) |
| g.
Chicken Response |
- Vaccination Protocol:
The birds were immunized intramuscularly with 50 μg plasmid DNA in the quadricep muscle of the hind limb (Kumar et al., 2009).
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
Birds immunized with pibdVP2-IRES-chiIL-2 plasmid at 21 days post-challenge showed the highest antibody titer. In addition, blood analysis showed a proliferation of CD4-positive cells in the group vaccinated with pibdVP2-IRES-chiIL-2 (Kumar et al., 2009).
- Challenge Protocol:
All vaccinated birds and the unvaccinated control birds were challenged with 10^5 ELD50 (50% embryo lethal dose) virulent IBDV (strain KT1/99) through the intrabursal and intraocular routes at 21 days post-immunization (Kumar et al., 2009).
- Efficacy:
Birds vaccinated with the pibdVP2-IRES-chiIL-2 plasmid showed an 80% protection efficacy (Kumar et al., 2009).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
91. rFPV-IBDV-VP 2.4.3 |
| a. Vaccine Ontology ID: |
| VO_0004750 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Gene Engineering of
VP2-VP4-VP3 |
- Type:
Recombinant vector construction
- Description:
Recombinant FPV-VP 2.4.3 contained the gene for the VP 2-VP4-VP3 polyprotein under the control of the vaccinia virus late promoter P.L 11 inserted within the thymidine kinase (TK) gene of FPV (Heine and Boyle, 1993).
- Detailed Gene Information: Click here.
|
| f. Preparation |
| Recombinant FPV-VP 2.4.3 contained the gene for the VP 2-VP4-VP3 polyprotein under the control of the vaccinia virus late promoter P.L 11 inserted within the thymidine kinase (TK) gene of FPV (Heine and Boyle, 1993). |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Chicken Response |
- Vaccination Protocol:
Vaccination with FPV-VP2 (Heine and Boyle, 1993).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
The birds were challenged with IBDV (strain 002-73) (Heine and Boyle, 1993).
- Efficacy:
A significant level of protection was provided by FPV-VP2 vaccination, although the level was lower than the protection provided by an oil adjuvanted inactivated whole IBDV vaccine. Birds vaccinated with FPV-VP2.4.3 were not protected from infection as assessed by ELISA for the presence of IBD virus in bursae (Heine and Boyle, 1993).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
92. rFPV-IBDV-VP2 |
| a. Vaccine Ontology ID: |
| VO_0004625 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Chicken |
| e. Gene Engineering of
VP2 |
- Type:
Recombinant vector construction
- Description:
Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000).
- Detailed Gene Information: Click here.
|
| f. Preparation |
| Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000). |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Chicken Response |
- Vaccination Protocol:
Chickens vaccinated with the rFPV or rMDV alone, or vaccinated simultaneously with both at their hatch (rMDV-rFPV(1d)) (Tsukamoto et al., 2000).
- Vaccine Immune Response Type:
VO_0003057
- Efficacy:
Most chickens were protected against developing clinical signs and mortality; however, only zero to 14% of the chickens were protected against gross lesions (Tsukamoto et al., 2000).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
93. rMDV-IBDV-VP2 |
| a. Vaccine Ontology ID: |
| VO_0004749 |
| b. Type: |
| Recombinant vector vaccine |
| c. Status: |
| Research |
| d. Host Species for Licensed Use: |
| Baboon |
| e. Gene Engineering of
VP2 |
- Type:
Recombinant vector construction
- Description:
IBDV host-protective antigen VP2 was expressed in a recombinant vaccine vector (Tsukamoto et al., 2000).
- Detailed Gene Information: Click here.
|
| f. Preparation |
| Marek's disease and Fowlpox viruses expressing the vvIBDV host-protective antigen VP2 (rMDV, rFPV) (Tsukamoto et al., 2000). |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Chicken Response |
- Vaccination Protocol:
Chickens vaccinated with the rFPV or rMDV alone, or vaccinated simultaneously with both at their hatch (rMDV-rFPV(1d)) (Tsukamoto et al., 2000).
- Vaccine Immune Response Type:
VO_0003057
- Efficacy:
Most chickens were protected against developing clinical signs and mortality; however, only zero to 14% of the chickens were protected against gross lesions (Tsukamoto et al., 2000).
|
|
|
|
 |
|
 |
|
|
| IV. References |
1. Butter et al., 2013: Butter C, Staines K, van Hateren A, Davison TF, Kaufman J. The peptide motif of the single dominantly expressed class I molecule of the chicken MHC can explain the response to a molecular defined vaccine of infectious bursal disease virus (IBDV). Immunogenetics. 2013; 65(8); 609-618. [PubMed: 23644721].
2. Gao et al., 2013: Gao H, Li K, Gao L, Qi X, Gao Y, Qin L, Wang Y, Wang X. DNA prime-protein boost vaccination enhances protective immunity against infectious bursal disease virus in chickens. Veterinary microbiology. 2013; 164(1-2); 9-17. [PubMed: 23419823].
3. Ge et al., 2015: Ge J, An Q, Song S, Gao D, Ping W. Construction of Recombinant Baculoviruses Expressing Infectious Bursal Disease Virus Main Protective Antigen and Their Immune Effects on Chickens. PloS one. 2015; 10(7); e0132993. [PubMed: 26167907].
4. Heine and Boyle, 1993: Heine HG, Boyle DB. Infectious bursal disease virus structural protein VP2 expressed by a fowlpox virus recombinant confers protection against disease in chickens. Archives of virology. 1993; 131(3-4); 277-292. [PubMed: 8394069].
5. Kumar et al., 2009: Kumar S, Ahi YS, Salunkhe SS, Koul M, Tiwari AK, Gupta PK, Rai A. Effective protection by high efficiency bicistronic DNA vaccine against infectious bursal disease virus expressing VP2 protein and chicken IL-2. Vaccine. 2009; 27(6); 864-869. [PubMed: 19111591].
6. Li et al., 2013: Li K, Gao H, Gao L, Qi X, Gao Y, Qin L, Wang Y, Wang X. Adjuvant effects of interleukin-18 in DNA vaccination against infectious bursal disease virus in chickens. Vaccine. 2013; 31(14); 1799-1805. [PubMed: 23395585].
7. Tsukamoto et al., 2000: Tsukamoto K, Sato T, Saito S, Tanimura N, Hamazaki N, Mase M, Yamaguchi S. Dual-viral vector approach induced strong and long-lasting protective immunity against very virulent infectious bursal disease virus. Virology. 2000; 269(2); 257-267. [PubMed: 10753704].
8. Wiki: Infectious Bursal Disease: Wiki: Infectious Bursal Disease [http://en.wikipedia.org/wiki/Infectious_bursal_disease]
9. Zhang et al., 2014: Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY. BacMam virus-based surface display of the infectious bronchitis virus (IBV) S1 glycoprotein confers strong protection against virulent IBV challenge in chickens. Vaccine. 2014; 32(6); 664-670. [PubMed: 24342247].
|