|
Infectious Bronchitis Virus (IBV) |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Microbial Pathogenesis
- Host Ranges and Animal Models
- Vaccine Related Pathogen Genes
- M membrane protein
(Protective antigen)
- N protein
(Protective antigen)
- S1
(Protective antigen)
- S1
(Protective antigen)
- S1
(Protective antigen)
- Vaccine Information
- Ac-CMV-S1 (infectious bronchitis virus)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.11)
- Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.1M)
- Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.20)
- Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.21)
- Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.22)
- Bronchitis Conn Type, Live Virus Vaccine (USDA: 1231.15)
- Bronchitis Delaware Type, Modified Live Virus Vaccine (USDA: 1231.1D)
- Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1J)
- Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1L)
- Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1235.15)
- Bronchitis Mass & Ark Types, Live Virus Vaccine (USDA: 1231.13)
- Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.14)
- Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.1G)
- Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA:1231.1N)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.12)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.18)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1A)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1F)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.10)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.15)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1233.10)
- Bronchitis Mass Type, Live Virus Vaccine (USDA: 1235.10)
- Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M)
- Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43)
- Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62)
- Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45)
- Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42)
- Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0)
- IBV DNA vaccine pVAX-S1 with GM-CSF adjuvant
- IBV DNA vaccine pVAX1-16S1/M/N
- IBV DNA vaccine pVAX1-N
- IBV Vaccine SZ200
- Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M
- Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.10)
- Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.11)
- Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.13)
- Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.1A)
- Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1762.13)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 1791.1X)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1M)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1N)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A2.1M)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.14)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.15)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.17)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1762.1H)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.14)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.15)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.11)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.12)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.18)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.19)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1762.11)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.19)
- Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.1X)
- Newcastle-Bronchitis B1 Type, C2 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1XC1.10)
- Newcastle-Bronchitis B1 Type, C2 Strain, Mass Type, Live Virus Vaccine (USDA: 1XB1.10)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types Vaccine (USDA: 17B1.17)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.14)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.17)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.11)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.12)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.18)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.19)
- Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.1A)
- Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.10)
- Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.12)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.10)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.11)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1776.10)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1785.11)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B5.10)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B6.10)
- Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D6.10)
- Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.10)
- Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.11)
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11120 |
2. Disease: |
Infectious Bronchitis |
3. Introduction |
Avian infectious bronchitis virus (IBV) is a coronavirus which infects poultry, causing the associated disease, infectious bronchitis (IB) (Wiki: Infectious Bronchitis Virus). Infectious bronchitis is an acute, rapidly spreading, viral disease of chickens characterized by respiratory signs, decreased egg production, and poor egg quality. Some strains of the causative virus, infectious bronchitis virus (IBV), are nephropathogenic. The latter strains produce interstitial nephritis resulting in significant mortality. Infectious bronchitis is of major economic importance to commercial chicken producers worldwide. IBV is shed by infected chickens in respiratory discharges and feces. The highly contagious virus is spread by airborne droplets, ingestion of contaminated feed and water, and contaminated equipment and clothng of caretakers. Naturally infected chickens and those vaccinated with live IBV may intermittently shed virus for many weeks or even months. Virus infection in layers and breeders occurs cyclically as immunity declines or on exposure to different serotypes. (Merck Vet Manual: Infectious Bronchitis). |
4. Microbial Pathogenesis |
Infectious bronchitis virus initially infects and replicates in the upper-respiratory tract causing the loss of protective cells lining the sinuses and trachea. After a brief viremia, the virus can be detected in the kidneys, reproductive tract, and cecal tonsils. Some strains of IBV, which are referred to as nephropathogenic are known to cause lesions in the kidney. Renal damage associated with different IB strains is an increasingly important feature of IB infections, especially in broiler chickens (Infectious-bronchitis.net). |
5. Host Ranges and Animal Models |
It is generally accepted that chickens are the most important natural hosts of IBV; all ages of chickens can be infected. IBV, or closely related coronaviruses have also been isolated from other species such as turkeys, pheasants, quail and partridges (Infectious-bronchitis.net). |
II. Vaccine Related Pathogen Genes |
1. M membrane protein |
-
Gene Name :
M membrane protein
-
Sequence Strain (Species/Organism) :
Infectious bronchitis virus
-
NCBI Gene ID :
1489743
-
NCBI Protein GI :
9626542
-
Locus Tag :
IBVgp4
-
Genbank Accession :
M22014
-
Protein Accession :
NP_040835
-
Taxonomy ID :
11120
-
Gene Starting Position :
24504
-
Gene Ending Position :
25181
-
Gene Strand (Orientation) :
+
-
Protein Name :
membrane protein
-
Protein pI :
8.3
-
Protein Weight :
23788.52
-
Protein Length :
225
-
Protein Note :
ORF for gene 4
-
DNA Sequence : Show Sequence
>NC_001451.1:24504-25181 Avian infectious bronchitis virus, complete genome
GATGCCCAACGAGACAAATTGTACTCTTGACTTTGAACAGTCAGTTCAGCTTTTTAAAGAGTATAATTTA
TTTATAACTGCATTCTTGTTGTTCTTAACCATAATACTTCAGTATGGCTATGCAACAAGAAGTAAGGTTA
TTTATACACTGAAAATGATAGTGTTATGGTGCTTTTGGCCCCTTAACATTGCAGTAGGTGTAATTTCATG
TACATACCCACCAAACACAGGAGGTCTTGTCGCAGCGATAATACTTACAGTGTTTGCGTGTCTGTCTTTT
GTAGGTTATTGGATCCAGAGTATTAGACTCTTTAAGCGGTGTAGGTCATGGTGGTCATTTAATCCAGAAT
CTAATGCCGTAGGTTCAATACTCCTAACTAATGGTCAACAATGTAATTTTGCTATAGAGAGTGTGCCAAT
GGTGCTTTCTCCAATTATAAAGAATGGTGTTCTTTATTGTGAGGGTCAGTGGCTTGCTAAGTGTGAACCA
GACCACTTGCCTAAAGATATATTTGTTTGTACACCGGATAGACGTAATATCTACCGTATGGTGCAGAAAT
ATACTGGTGACCAAAGCGGAAATAAGAAAAGGTTTGCTACGTTTGTCTATGCAAAGCAGTCAGTAGATAC
TGGCGAGCTAGAAAGTGTAGCAACAGGAGGAAGTAGTCTTTACACATA
-
Protein Sequence : Show Sequence
>NP_040835.1 membrane protein [Infectious bronchitis virus]
MPNETNCTLDFEQSVQLFKEYNLFITAFLLFLTIILQYGYATRSKVIYTLKMIVLWCFWPLNIAVGVISC
TYPPNTGGLVAAIILTVFACLSFVGYWIQSIRLFKRCRSWWSFNPESNAVGSILLTNGQQCNFAIESVPM
VLSPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNIYRMVQKYTGDQSGNKKRFATFVYAKQSVDT
GELESVATGGSSLYT
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
IBV DNA vaccine pVAX1-16S1/M/N
,
Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M
|
2. N protein |
-
Gene Name :
N protein
-
Sequence Strain (Species/Organism) :
Infectious bronchitis virus strain M41 serotype Massachussets
-
NCBI Protein GI :
157058858
-
Other Database IDs :
CDD:279305
-
Taxonomy ID :
11120
-
Gene Strand (Orientation) :
?
-
Protein Name :
nucleocapsid protein
-
Protein pI :
10.29
-
Protein Weight :
43358
-
Protein Length :
479
-
Protein Note :
Coronavirus nucleocapsid protein; pfam00937
-
Protein Sequence : Show Sequence
>ABV03163.1 nucleocapsid protein [Infectious bronchitis virus]
MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNVSWFQAIKAKKLNSPPPKFEGSGVPDNENLKPSQQHGY
WRRQARFKPGKGGRKPVPDAWYFYYTGTGPAANLNWGDSQDGIVWVAGKGADTKFRSNQGTRDSDKFDQY
PLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREVSRGRRSGSEDDLIARAARIIQDQQKK
GSRITKAKADEMAHRRYCKRTIPPNYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHA
CLFGSRVTPRLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPTDDEPRPKSRSSSKPATRG
NSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
IBV DNA vaccine pVAX1-16S1/M/N
,
IBV DNA vaccine pVAX1-N
,
Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M
|
3. S1 |
-
Gene Name :
S1
-
Sequence Strain (Species/Organism) :
Infectious bronchitis virus
-
NCBI Protein GI :
55501832
-
Other Database IDs :
CDD:279880
-
Taxonomy ID :
11120
-
Gene Strand (Orientation) :
?
-
Protein Name :
S1
-
Protein pI :
7.94
-
Protein Weight :
57519.94
-
Protein Length :
621
-
Protein Note :
Coronavirus S1 glycoprotein; pfam01600
-
Protein Sequence : Show Sequence
>AAV52771.1 S1, partial [Infectious bronchitis virus]
MLVKSLFIVTLLFALCSANLYDNGNYVYYYQSAFRPSGGWHLHGGAYAVVNVSQETSNAGSSSQCITGAI
HWSKNFSASSVAMTAPSNGMEWSSSQFCTAHCNFSNIVVFVTHCFKSGAGFCPLTGLIPKGYIRIAAMKQ
GGNGPSDLFYNLTVPVTKYPKFRSLQCVNNQTSVYLNGDLVFTSNETEDVSGSGVYFKAGGPITYKVMRE
VKALAYFVNGTAHDVILCDDTPRGLLACQYNTGNFSDGFYPFTNSSLVKEKFIVYRENSVNTTLVLHNFT
FYNETAAQPNSGGVNSIQTYQTQTAQSGYYNFNFSFLSGFVYKEFNFMYGSYHPKCNFRPENINNGLWFN
SLSVSLAYGPLQGGCKQSVFHGRATCCYAYSYLGPRLCKGVYSGELTQQFECGLLVYITKSDGSRIQTAT
EPPVITQHNYNNITLNKCVEYNIYGRFGQGFITNVTDSAASYNYLSDGGLATLDTSGAIDIFVVQGEYGL
NYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQAIENQFYIKLTNGSRRSRRSVNENVTNCPYVSY
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
Ac-CMV-S1 (infectious bronchitis virus)
,
IBV DNA vaccine pVAX-S1 with GM-CSF adjuvant
,
IBV DNA vaccine pVAX1-16S1/M/N
,
Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M
|
4. S1 |
-
Gene Name :
S1
-
Sequence Strain (Species/Organism) :
Infectious Bronchitis Virus (IBV)
-
NCBI Protein GI :
ASV64866
-
Other Database IDs :
CDD:279880
-
Taxonomy ID :
11120
-
Protein Name :
S1 spike glycoprotein
-
Protein pI :
9.84
-
Protein Weight :
12909.42
-
Protein Length :
201
-
Protein Note :
S1
-
Protein Sequence : Show Sequence
>ASV64866.1 S1 spike glycoprotein, partial [Infectious bronchitis virus]
RPSTGWHMHGGAYAVVNVSVEYRNAGSGQCTAGSIHWSKNFSASSVAMTAPVTGMSWSVSQFCTSQCNFT
NFTVFVTHCYKNGRGSCPLTGLIPQEQIRISAMKNSSLFYNLTVAVTKYPRFKSL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Leyson et al., 2016)
|
5. S1 |
-
Gene Name :
S1
-
Sequence Strain (Species/Organism) :
Infectious Bronchitis Virus (IBV)
-
NCBI Protein GI :
AAQ63417
-
Other Database IDs :
CDD:279880
-
Taxonomy ID :
11120
-
Protein Name :
S1 glycoprotein
-
Protein pI :
8.35
-
Protein Weight :
55548.912
-
Protein Length :
621
-
Protein Note :
Coronavirus S1 glycoprotein; pfam01600
-
Protein Sequence : Show Sequence
>AAQ63417.1 S1 glycoprotein, partial [Infectious bronchitis virus]
MLVKSLFLVTLLFALCSATLYDNDTYVYYYQSAFRPPVGWHLHGGAYAVVNVSQETNNAGSASQCTAGAI
HWSKNFSAASVAMTTPPSGMDWSTSQFCTAHCNFSNIVVFVTHCYKSGNNACPLTGLINQGYIRISAMKQ
GGSGPADLFYNLTVPVTKYSKFRSLQCVNNQTSVYLNGDLVFTSNETTDVVGAGVSFKAGGPITYKVMRE
VKALAYFINGTAQDVILCDRSPRGLLACQYNTGNFSDGFYPFTNSSLVKEKFIVYRENSVNTTLVLHNFT
FHNETSAPPNTVGGVDSIKVYQTQIAQSGYYNFNFSFLSGFVYKESDFMYGSYHKSCNFRPESINNGLWF
NSLTVSLAYGPLQGGCKQSVFNGKATCCYAYSYNGPRACKGVYRGELQTSFECGLLVFITKSDGSRIQTA
AQVPVITTNFYNNITLNKCVDYNIYGRVGQGFITNVTDSAATYNYLAVGGLAILDTSGAIDIFVVQGAYG
PNFYKVNPCDDVNQQFVVSGGNIVGILTSRNEXGSQLLENQFFIKLTNGTRRFKR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Zhang et al., 2014)
|
III. Vaccine Information |
|
|
|
|
|
|
1. Ac-CMV-S1 (infectious bronchitis virus) |
a. Vaccine Ontology ID: |
VO_0004753 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Research |
d. Host Species for Licensed Use: |
Baboon |
e. Gene Engineering of
S1 |
- Type:
Recombinant vector construction
- Description:
The BacMam virus Ac-CMV-S1, which expressed the S1 glycoprotein of IBV-M41 (Zhang et al., 2014).
- Detailed Gene Information: Click here.
|
f. Preparation |
BV-Dual-S1 expresses the S1 glycoprotein of IBV-M41 on the baculovirus envelope, and is capable of expressing it in mammalian cells (Zhang et al., 2014). |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Chicken Response |
- Vaccination Protocol:
The chickens were immunized with BV-Dual-S1 or an inactivated vaccine (Zhang et al., 2014).
- Vaccine Immune Response Type:
VO_0003057
- Challenge Protocol:
The immunized chickens were challenged with a virulent IBV-M41 (Zhang et al., 2014).
- Efficacy:
A significant difference was not observed for protection rates between chickens immunized with BV-Dual-S1 (83%) or inactivated vaccine (89%) following challenge with virulent IBV-M41. Our findings show that the protective efficacy of BV-Dual-S1 could be significantly enhanced by baculovirus display technology (Zhang et al., 2014).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.11) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001610 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.1M) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001611 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.20) |
a. Manufacturer: |
Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001612 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.21) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001613 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Bronchitis Ark Type, Live Virus Vaccine (USDA: 1231.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001614 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Bronchitis Conn Type, Live Virus Vaccine (USDA: 1231.15) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001615 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Bronchitis Delaware Type, Modified Live Virus Vaccine (USDA: 1231.1D) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001616 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1J) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001617 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Bronchitis Georgia Type, Live Virus Vaccine (USDA: 1231.1L) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001618 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1235.15) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0001619 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Bronchitis Mass & Ark Types, Live Virus Vaccine (USDA: 1231.13) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001620 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.14) |
a. Manufacturer: |
Wyeth, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001621 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA: 1231.1G) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001622 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Bronchitis Mass & Conn Types, Live Virus Vaccine (USDA:1231.1N) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001623 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.12) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0001624 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.18) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0001625 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1A) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001626 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1231.1F) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001627 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.10) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001628 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1232.15) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001629 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1233.10) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001630 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Bronchitis Mass Type, Live Virus Vaccine (USDA: 1235.10) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0001631 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.4M) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002069 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Bursal Disease-Newcastle Disease-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 12H1.67) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002070 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.40) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002071 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.43) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002072 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Bursal Disease-Newcastle Disease-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 12J5.62) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002074 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12D5.45) |
a. Manufacturer: |
Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002060 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Bursal Disease-Newcastle Disease-Bronchitis Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12J5.61) |
a. Manufacturer: |
Intervet Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002073 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00) |
a. Manufacturer: |
Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0002075 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0002076 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002078 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002077 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002081 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002082 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002083 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002084 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41) |
a. Manufacturer: |
Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002079 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002080 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002085 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. IBV DNA vaccine pVAX-S1 with GM-CSF adjuvant |
a. Vaccine Ontology ID: |
VO_0004582 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Chickens |
e. Gene Engineering of
S1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pVAX1 (Tan et al., 2009) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Mouse Response |
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
Vaccination with pVAX-S1 plus pVAX-chGM-CSF induced a level of anti-IBV antibodies that was significantly higher than in animals receiving pVAX-S1 alone (P < 0.05) beginning on the seventh day after booster vaccination (Tan et al., 2009).
- Efficacy:
PBS and pVAX1 immunized groups had 0% protection efficacy. The protection efficacy in the group vaccinated with the pVAX-S1 plus pVAX- chGM-CSF was 86.7%, whereas for the group vaccinated with pVAX-S1 alone, it was 73.3%. These results suggest that chGM-CSF, used as a molecular adjuvant, can improve the protection efficacy of an IBV S1 protein DNA vaccine (Tan et al., 2009).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. IBV DNA vaccine pVAX1-16S1/M/N |
a. Vaccine Ontology ID: |
VO_0004535 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Chickens |
e. Antigen |
S1, N, and M proteins of the virulent IBVSX16 strain (Yan et al., 2013) |
f. Gene Engineering of
M membrane protein |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
g. Gene Engineering of
N protein |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
h. Gene Engineering of
S1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
i. Vector: |
pVAX1 prime, inactivated IBV vaccine boost (Yan et al., 2013) |
j. Immunization Route |
Intramuscular injection (i.m.) |
k.
Chicken Response |
- Vaccination Protocol:
Chickens were immunized with the multivalent DNA vaccine twice and then boosted with an inactivated vaccine once (Yan et al., 2013).
- Immune Response:
Antibody titers of the chickens immunized with pVAX1-16S1/M/N were much higher than those of the monovalent groups (p < 0.01) (Yan et al., 2013).
- Efficacy:
A protective rate up to 90% was observed in the pVAX1-16S1/M/N group (Yan et al., 2013).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
44. IBV DNA vaccine pVAX1-N |
a. Vaccine Ontology ID: |
VO_0004581 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Chickens |
e. Gene Engineering of
N protein |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pVAX1 prime, inactivated IBV vaccine boost (Guo et al., 2010) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Chicken Response |
- Vaccine Immune Response Type:
VO_0003057
- Efficacy:
Priming with a DNA vaccine encoding nucleocapsid protein (pVAX1-N) and boosting with the inactivated IBV vaccine provided up to 86.7% rate of immune protection, compared to the lack of protection seen in the PBS-immunized group, where the death rate was 66.7% (Guo et al., 2010).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
45. IBV Vaccine SZ200 |
a. Type: |
Live, attenuated vaccine |
b. Status: |
Research |
c. Host Species for Licensed Use: |
None |
d. Host Species as Laboratory Animal Model: |
chicken |
e. Antigen |
GI-19 genotype vaccine strain SZ (Zhao et al., 2019) |
f. Preparation |
The GI-19 genotype vaccine strain, SZ200, was attenuated in our laboratory with 200 serial passages in SPF embryonated chicken eggs via the allantoic sac route. (Zhao et al., 2019) |
g. Immunization Route |
intranasal immunization |
h. Description |
Live attenuated SZ200 vaccine protects chickens against IBV challenge. (Zhao et al., 2019) |
i.
Chicken Response |
- Vaccination Protocol:
Seventy-five 14-day-old SPF chickens were divided into six groups of 15 or 10 birds. Groups A (15 birds) and B (10 birds) were used as the negative controls. Groups C (15 birds) and D (10 birds) were vaccinated intranasally with 103.5 EID50 SZ200. Groups E (15 birds) and F (10 birds) were left unvaccinated. (Zhao et al., 2019)
- Immune Response:
c. The unvaccinated challenged group C showed a maximum average ciliostasis score of 4, whereas the average ciliostasis score in the SZ200-vaccinated group was <2. The difference in ciliostasis was extremely significant between the SZ200-vaccinated group and the unvaccinated group (p < 0.01). Significant reductions in the postchallenge viral load in the tissues of the SZ 200-vaccinated groups were detected at 3, 5, and 7 dpc compared with those in the unvaccinated group (p < 0.05). (Zhao et al., 2019)
- Side Effects:
In terms of the clinical manifestations, no gross lesions were observed in the SZ200-vaccinated group. (Zhao et al., 2019)
- Challenge Protocol:
All groups were challenged intranasally with LGD at a dose of 10^6.0 EID50/bird at 14 days postvaccination. (Zhao et al., 2019)
- Efficacy:
Compared with the unvaccinated challenged group (60% morbidity, 10% mortality), the SZ200 vaccine reduced the morbidity and mortality of the chickens infected with LGD. (Zhao et al., 2019)
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46. Infectious Bronchitis Virus DNA Vaccine encoding S1, N, and M |
a. Vaccine Ontology ID: |
VO_0004584 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Gene Engineering of
N protein |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
e. Gene Engineering of
S1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
M membrane protein |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Chicken Response |
- Vaccination Protocol:
The seven day old SPF chickens were randomly divided into six groups with 20 chickens per group. Groups 1–3 received 100 micro-g of pVAX1-S1, PVAX1-M, or pVAX1-N,
respectively; Group 4 received 100 micro-g combined DNA vaccine containing 33 micro-g of each of the three antigen plasmids; Groups 5–6 received 100 micro-g empty pVAX1 and 0.5 ml PBS. All the chickens were immunized intramuscularly with the vaccines at seven days of age (Yang et al., 2009).
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
Anti-IBV antibody levels were detected in chickens immunized with either pVAX1-S1, pVAX1-M, pVAX1-N or the three constructs in combination. In fact, a higher antibody titer level was observed in chickens immunized with the three expression constructs in combination compared with the individual constructs, suggesting a greater potency for inducing antibody response (Yang et al., 2009).
- Challenge Protocol:
All chickens were challenged with 100EID50 of the IBV SAIBk strain in 0.1 ml by a nasal-ocular route at 21 days after the boost immunization (Yang et al., 2009).
- Efficacy:
Immunization with the multivalent DNA vaccine provided up to 85% immune protection in the vaccinated chickens (Yang et al., 2009).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
47. Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.10) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002282 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
48. Newcastle Disease-Bronchitis Mass & Ark Types, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D7.11) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002283 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
49. Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.13) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002150 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
50. Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1761.1A) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002156 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
51. Newcastle-Bronchitis B1 Type, B1 Strain, Conn Type, Live Virus Vaccine (USDA: 1762.13) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002158 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
52. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 1791.1X) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002176 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
53. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1M) |
a. Manufacturer: |
Wyeth, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002177 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
54. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A1.1N) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002178 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
55. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Ark Types, Live Virus Vaccine (USDA: 17A2.1M) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002179 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
56. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.14) |
a. Manufacturer: |
Wyeth, Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002151 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
57. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.15) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002152 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
58. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1761.17) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002153 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
59. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1762.1H) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002159 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
60. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.14) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002173 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
61. Newcastle-Bronchitis B1 Type, B1 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1791.15) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002174 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
62. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.11) |
a. Manufacturer: |
Wyeth, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002148 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
63. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.12) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002149 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
64. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.18) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002154 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
65. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1761.19) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002155 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
66. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1762.11) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002157 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
67. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.19) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002175 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
68. Newcastle-Bronchitis B1 Type, B1 Strain, Mass Type, Live Virus Vaccine (USDA: 1791.1X) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0004208 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
69. Newcastle-Bronchitis B1 Type, C2 Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1XC1.10) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002204 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
70. Newcastle-Bronchitis B1 Type, C2 Strain, Mass Type, Live Virus Vaccine (USDA: 1XB1.10) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002203 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
71. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types Vaccine (USDA: 17B1.17) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002180 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
72. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.14) |
a. Manufacturer: |
Intervet Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002162 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
73. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 1771.17) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002163 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
74. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.11) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002160 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
75. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.12) |
a. Manufacturer: |
Wyeth, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002161 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
76. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.18) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002164 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
77. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.19) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002165 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
78. Newcastle-Bronchitis B1 Type, LaSota Strain, Mass Type, Live Virus Vaccine (USDA: 1771.1A) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002166 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
79. Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.10) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002170 |
c. Status: |
Licensed |
d. Location Licensed: |
USA |
e. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
80. Newcastle-Bronchitis Mass & Ark Types, Killed Virus Vaccine (USDA: 1785.12) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002172 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
81. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.10) |
a. Manufacturer: |
Wyeth, Biomune Company |
b. Vaccine Ontology ID: |
VO_0002167 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
82. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1775.11) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002168 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
83. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1776.10) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002169 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
84. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine (USDA: 1785.11) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002171 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
85. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B5.10) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002275 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
86. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B6.10) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002276 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
87. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Salmonella Enteritidis Bacterin (USDA: 48D6.10) |
a. Manufacturer: |
Wyeth, Intervet Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002281 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
88. Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.10) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002185 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
89. Newcastle-Bronchitis VG/GA Strain, Mass & Conn Types, Live Virus Vaccine (USDA: 17V1.11) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002186 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
|
|
|
|
|
IV. References |
1. Guo et al., 2010: Guo Z, Wang H, Yang T, Wang X, Lu D, Li Y, Zhang Y. Priming with a DNA vaccine and boosting with an inactivated vaccine enhance the immune response against infectious bronchitis virus. Journal of virological methods. 2010; 167(1); 84-89. [PubMed: 20307574].
2. Infectious-bronchitis.net: Information about Infectious Bronchitis in chickens and control of disease [http://www.infectious-bronchitis.com]
3. Leyson et al., 2016: Leyson C, França M, Jackwood M, Jordan B. Polymorphisms in the S1 spike glycoprotein of Arkansas-type infectious bronchitis virus (IBV) show differential binding to host tissues and altered antigenicity. Virology. 2016; 498; 218-225. [PubMed: 27619927].
4. Merck Vet Manual: Infectious Bronchitis: Merck Veterinary Manual: Infectious Bronchitis [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/206500.htm]
5. Tan et al., 2009: Tan B, Wang H, Shang L, Yang T. Coadministration of chicken GM-CSF with a DNA vaccine expressing infectious bronchitis virus (IBV) S1 glycoprotein enhances the specific immune response and protects against IBV infection. Archives of virology. 2009; 154(7); 1117-1124. [PubMed: 19543689].
6. Wiki: Infectious Bronchitis Virus: Wiki: Infectious Bronchitis Virus [http://en.wikipedia.org/wiki/Avian_infectious_bronchitis_virus]
7. Yan et al., 2013: Yan F, Zhao Y, Hu Y, Qiu J, Lei W, Ji W, Li X, Wu Q, Shi X, Li Z. Protection of chickens against infectious bronchitis virus with a multivalent DNA vaccine and boosting with an inactivated vaccine. Journal of veterinary science. 2013; 14(1); 53-60. [PubMed: 23388447].
8. Yang et al., 2009: Yang T, Wang HN, Wang X, Tang JN, Gao R, Li J, Guo ZC, Li YL. Multivalent DNA vaccine enhanced protection efficacy against infectious bronchitis virus in chickens. The Journal of veterinary medical science / the Japanese Society of Veterinary Science. 2009; 71(12); 1585-1590. [PubMed: 20046025].
9. Zhang et al., 2014: Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY. BacMam virus-based surface display of the infectious bronchitis virus (IBV) S1 glycoprotein confers strong protection against virulent IBV challenge in chickens. Vaccine. 2014; 32(6); 664-670. [PubMed: 24342247].
10. Zhang et al., 2014: Zhang J, Chen XW, Tong TZ, Ye Y, Liao M, Fan HY. BacMam virus-based surface display of the infectious bronchitis virus (IBV) S1 glycoprotein confers strong protection against virulent IBV challenge in chickens. Vaccine. 2014; 32(6); 664-670. [PubMed: 24342247].
|
|