1. NCBI Taxonomy ID: |
11246 |
2. Disease: |
Respiratory Disease |
3. Introduction |
Bovine respiratory syncytial virus (BRSV) is an RNA virus classified as a pneumovirus in the paramyxovirus family. This virus was named for its characteristic cytopathic effect—the formation of syncytial cells. In additional to cattle, sheep and goats can also be infected by respiratory syncytial viruses. Human respiratory syncytial virus (HRSV) is an important respiratory pathogen in infants and young children. Antigenic subtypes are known to exist for HRSV, and preliminary evidence suggests that there may be antigenic subtypes of BRSV. BRSV is distributed worldwide, and the virus is indigenous in the cattle population. BRSV infections associated with respiratory disease occur predominantly in young beef and dairy cattle. Passively derived immunity does not appear to prevent BRSV infections but will reduce the severity of disease. Initial exposures to the virus are associated with severe respiratory disease; subsequent exposures result in mild to subclinical disease. BRSV is an important virus in the bovine respiratory disease complex because of its frequency of occurrence, predilection for the lower respiratory tract, and ability to predispose the respiratory tract to secondary bacterial infection. In outbreaks, morbidity tends to be high, and the case fatality rate can be 0-20% (Merck Vet Manual: BRSV). |
4. Host Ranges and Animal Models |
Cattle |
II. Vaccine Related Pathogen Genes |
1. F |
-
Gene Name :
F
-
Sequence Strain (Species/Organism) :
Bovine respiratory syncytial virus strain Snook
-
NCBI Protein GI :
3451386
-
Other Database IDs :
CDD:278924
GOA:O90698 HSSP: 1G2C InterPro: IPR000776 InterPro: IPR013055 UniProtKB/TrEMBL: O90698
-
Taxonomy ID :
11246
-
Gene Strand (Orientation) :
?
-
Protein Name :
F protein
-
Protein pI :
9.09
-
Protein Weight :
59125.88
-
Protein Length :
632
-
Protein Note :
Fusion glycoprotein F0; pfam00523
-
Protein Sequence : Show Sequence
>CAA76980.1 F protein [Bovine orthopneumovirus]
MATTAMTMIISIIFISTYVTHITLCQNITEEFYQSTCSAVSRGYLSALRTGWYTSVVTIELSKIQKNVCK
STDSKVKLIKQELERYNNAVVELQSLMQNEPASFSRAKRSIPELIHYTRNSTKKFYGLMGKKRKRRFLGF
LLGIGSAIASGVAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKELLPKVNNH
DCRISNIATVIEFQQKNNRLLEIAREFSVNAGITTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQI
VRQQSYSIMSVVKEEVIAYVVQLPIYGVIDTPCWKLHTSPLCTTDNKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPTDVNLCNTDIFNTKYDCKIMTSKTDISSSVITSIGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKALYIKGEPIINYYDPLVFPSDEFDA
SIAQVNAKINQSLAFIRRSDELLHSVDVGKSTTNVVITTIIIVIVVVILMLIAVGLLFYCKTRSTPIMLG
KDQLSGINNLSFSK
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
BRSV DNA vaccine VCL-Fb
|
2. glycoprotein G |
-
Gene Name :
glycoprotein G
-
Sequence Strain (Species/Organism) :
Bovine respiratory syncytial virus
-
NCBI Gene ID :
1489813
-
NCBI Protein GI :
9631274
-
Locus Tag :
BovRSVgp07
-
Genbank Accession :
AF092942
-
Protein Accession :
NP_048054
-
3D structure: PDB ID :
1BRV
-
Taxonomy ID :
11246
-
Gene Starting Position :
4689
-
Gene Ending Position :
5528
-
Gene Strand (Orientation) :
+
-
Protein Name :
mRNA
-
Protein pI :
10.63
-
Protein Weight :
27981.73
-
Protein Length :
257
-
DNA Sequence : Show Sequence
>gi|9631267:4689-5528 Bovine respiratory syncytial virus, complete genome
TGGGGCAAATACAAGTATGTCCAACCATACCCACCATCTTAAATTCAAGACATTAAAGAGGGCTTGGAAA
GCCTCAAAATACTTCATAGTAGGATTATCATGTTTATATAAGTTCAATTTAAAATCCCTTGTCCAAACGG
CTTTGACCACCTTAGCAATGATAACCTTGACATCACTCGTCATAACAGCCATTATTTACATTAGTGTGGG
AAATGCTAAAGCCAAGCCCACATCCAAACCAACCATCCAACAAACACAACAGCCCCAAAACCATACCTCA
CCATTTTTCACAGAGCACAACTACAAATCAACTCACACATCAATTCAAAGCACCACACTGTCCCAACTAC
CAAACACAGACACCACTAGAGAAACTACATACAGTCACTCAATCAACGAAACCCAAAACAGAAAAATCAA
AAGCCAATCCACTCTACCCGCCACCAGAAAACCACCAATTAACCCATCGGGAAGCAACCCCCCTGAAAAC
CACCAAGACCACAACAACTCCCAAACACTCCCCTATGTGCCTTGCAGTACATGTGAAGGTAATCTTGCTT
GTTTATCACTCTGCCAAATCGGGCCGGAGAGAGCACCAAGCAGAGCCCCTACAATCACCCTCAAAAAGAC
TCCAAAACCCAAAACCACCAAAAAGCCAACCAAGACAACAATCCACCACAGAACCAGCCCTGAAGCCAAA
CTGCAACCCAAAAACAACACGGCAGCTCCACAACAAGGCATCCTCTCTTCACCAGAACACCACACAAATC
AATCAACTACACAGATCTAACAACACACCTCCATATAATATCAATTATGTTCATATATAGTTATTTAAAA
-
Protein Sequence : Show Sequence
>gi|9631274|ref|NP_048054.1| G [Bovine respiratory syncytial virus]
MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAIIYISVGNAKAK
PTSKPTIQQTQQPQNHTSPFFTEHNYKSTHTSIQSTTLSQLPNTDTTRETTYSHSINETQNRKIKSQSTL
PATRKPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNLACLSLCQIGPERAPSRAPTITLKKTPKPKT
TKKPTKTTIHHRTSPEAKLQPKNNTAAPQQGILSSPEHHTNQSTTQI
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
A glycoprotein G deletion in bovine respiratory syncytial virus(rBRSV) and recombinant rBRSV was attenuated and provided protection against a BRSV challenge infection in calves (Schmidt et al., 2002).
- Related Vaccine(s):
Bovine respiratory syncytial virus glycoprotein G mutant vaccine
,
Bovine Respiratory Syncytial Virus recombinant vector vaccine BHVl/BRSVG encoding the G protein
|
3. M2 |
-
Gene Name :
M2
-
Sequence Strain (Species/Organism) :
Bovine Respiratory Syncytial Virus
-
NCBI Protein GI :
AAL49411
-
Other Database IDs :
CDD:214632
CDD:283973
-
Taxonomy ID :
11247
-
Protein Name :
M2-1 protein
-
Protein pI :
8.79
-
Protein Weight :
21321.46
-
Protein Length :
262
-
Protein Note :
original isolate
-
Protein Sequence : Show Sequence
>AAL49411.1 M2-1 protein [Bovine respiratory syncytial virus ATCC51908]
MSRRNPCKYEIRGHCLNGKKCHFSHNYFEWPPHALLVRQNFMLNKILKSMDRNNDTLSEISGAAELDRTE
EYALGVIGVLESYLSSINNITKQSACVAMSKLLAEINNDDIKRLRNKEVPTSPKIRIYNTVISYIDSNKR
NTKQTIHLLKRLPADVLKKTIKNTIDIHNEINGNNQGDINVDEQNE
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Blodörn et al., 2014)
|
4. N |
-
Gene Name :
N
-
Sequence Strain (Species/Organism) :
Bovine Respiratory Syncytial Virus
-
NCBI Protein GI :
ARJ54327
-
Other Database IDs :
CDD:308720
-
Taxonomy ID :
11246
-
Protein Name :
nucleoprotein
-
Protein pI :
9.76
-
Protein Weight :
23680.64
-
Protein Length :
296
-
Protein Note :
Pneumovirus nucleocapsid protein; pfam03246
-
Protein Sequence : Show Sequence
>ARJ54327.1 nucleoprotein, partial [Bovine orthopneumovirus]
MLLITEDANHKFTGLIGMLYAMSRLGREDTLKILKDAGYQVRANGVDVITHRQDVNGKEMKFEVLTLVSL
TSEVQGNIEIESRKSYKKMLKEMGEVASEYRHDAPDCGMIVLCVAALVITKLAAGDRSGLTAVIRRANNV
LRNEMKRYKGLIPKDIANSFYEVFEKYPHYIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAYGAGQVMLR
WGVLAKSVKNIMLGHASVQA
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Gershwin et al., 2017)
|
5. N |
-
Gene Name :
N
-
Sequence Strain (Species/Organism) :
Bovine Respiratory Syncytial Virus
-
NCBI Protein GI :
AAL49405
-
Other Database IDs :
CDD:281264
-
Taxonomy ID :
11247
-
Protein Name :
nucleocapsid protein
-
Protein pI :
7.22
-
Protein Weight :
41002.61
-
Protein Length :
478
-
Protein Note :
original isolate
-
Protein Sequence : Show Sequence
>AAL49405.1 nucleocapsid protein [Bovine respiratory syncytial virus ATCC51908]
MALSKVKLNDTFNKDQLLSTSKYTIQRSTGDNIDIPNYDVQKHLNKLCGMLLITEDANHKFTGLIGILYA
MSRLGREDTLKILKDAGYQVRANGVDVITHRQDVNGKEMKFEVLTLVSLTSEVQGNIEIESRKSYKKMLK
EMGEVAPEYRHDSPDCGMIVLCVAALVITKLAAGDRSGLTAVIRRANNVLRNEMKRYKGLIPKDIANSFY
EVIEKYPHYIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAYGAGQVMLRWGVLAKSVKNIMLGHASVQAE
MEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQFPNFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAA
KAYAEQLKENGVINYSVLDLTTEELEAIKNQLNPKDNDVEL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Blodörn et al., 2014)
|
6. P |
-
Gene Name :
P
-
Sequence Strain (Species/Organism) :
Bovine Respiratory Syncytial Virus
-
NCBI Protein GI :
AAL49406
-
Other Database IDs :
CDD:280615
-
Taxonomy ID :
11247
-
Protein Name :
phosphoprotein
-
Protein pI :
4.3
-
Protein Weight :
27092.97
-
Protein Length :
320
-
Protein Note :
original isolate
-
Protein Sequence : Show Sequence
>AAL49406.1 phosphoprotein [Bovine respiratory syncytial virus ATCC51908]
MEKFAPEFHGEDANTKATKFLESLKGKFTSSKDSRKKDSIISVNSIDIELPKESPITSTNHNINQPSEIN
DTIAANQVHIRKPLVSFKEELPSSENPFTKLYKETIETFDNNEEESSYSYDEINDQTNDNITARLDRIDE
KLSEIIGMLHTLVVASAGPTAARDGIRDAMVGLREEMIEKIRSEALMTNDRLEAMARLRDEESEKMTKDT
SDEVKLTPTSEKLNMVLEDESSDNDLSLEDF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Blodörn et al., 2014)
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Bovine Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1161.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001875 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Bovine Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1161.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001876 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Bovine respiratory syncytial virus glycoprotein G mutant vaccine |
a. Vaccine Ontology ID: |
VO_0002951 |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Cow |
e. Gene Engineering of
glycoprotein G |
- Type:
Gene mutation
- Description:
This glycoprotein G mutant is from Bovine respiratory syncytial virus (Schmidt et al., 2002).
- Detailed Gene Information: Click here.
|
f. Immunization Route |
intranasal immunization |
g.
Cattle Response |
- Persistence:
A glycoprotein G mutant is attenuated in calves (Schmidt et al., 2002).
- Efficacy:
A glycoprotein G mutant induces significant protection in calves from challenge with wild type BRSV (Schmidt et al., 2002).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Bovine Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1095.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001558 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Bovine Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1095.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001559 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Bovine Respiratory Syncytial Virus Killed Virus Vaccine-Haemophilus Somnus Bacterin (USDA: 40A5.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002205 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Bovine Respiratory Syncytial Virus recombinant vector vaccine BHVl/BRSVG encoding the G protein |
a. Vaccine Ontology ID: |
VO_0004289 |
b. Type: |
Recombinant vector vaccine |
c. Status: |
Licensed |
d. Host Species as Laboratory Animal Model: |
Calves |
e. Gene Engineering of
glycoprotein G |
- Type:
Recombinant vector construction
- Description:
The gE gene was replaced by a gene encoding the G protein of BRSV in a BHVI vector (Schrijver et al., 1997).
- Detailed Gene Information: Click here.
|
f. Vector: |
BHVI (Schrijver et al., 1997) |
g. Immunization Route |
intranasal immunization |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
Flow cytometric analysis showed a significant relative increase of gamma/delta+ T cells in peripheral blood after BRSV challenge-infection of the calves of the control group but not in the vaccinated groups. These results indicate that the G protein of BRSV can induce significant protection against BRSV infection in cattle, and that the BHV1/BRSV-G vaccine protects effectively against a subsequent BRSV and BHV1 infection (Schrijver et al., 1997).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Bovine Respiratory Syncytial Virus Vaccine Modified Live Virus (USDA: 1091.20) |
a. Manufacturer: |
Pfizer, Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001560 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001895 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.20) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Heska Corporation, Texas Vet Lab, Inc. |
b. Vaccine Ontology ID: |
VO_0001896 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.21) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001897 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001898 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Bovine Rhinotracheitis-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1071.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001899 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Bovine Rhinotracheitis-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11B5.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001900 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.00) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001939 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc., Heska Corporation, Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001940 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001941 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.22) |
a. Manufacturer: |
Wyeth, Intervet Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001942 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001943 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.24) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0001944 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001945 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.26) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001946 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.28) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001947 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 1181.30) |
a. Manufacturer: |
Intervet Inc., Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001948 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Merial, Inc., Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001949 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 1185.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0001950 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001951 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Haemophilus Somnus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44M5.22) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001952 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001953 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001954 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B6.21) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0001955 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001968 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.21) |
a. Manufacturer: |
Wyeth, Pfizer, Inc., Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001969 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.22) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001970 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
35. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1187.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001971 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
36. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.00) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001972 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
37. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.21) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001973 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
38. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine (USDA: 1189.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001974 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
39. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.21) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0001975 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
40. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live & Killed Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B9.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001976 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
41. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001982 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
42. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.22) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001983 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
43. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.23) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001984 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
44. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Campylobacter Fetus-Leptospira Canicola-Grippotyphosa-Hardjo-Icterohaemorrhagiae-Pomona Bacterin (USDA: 44B1.25) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0001985 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
45. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Hardjo Bacterin (USDA: 4L49.20) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002003 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
46. Bovine Rhinotracheitis-Virus Diarrhea-Parainfluenza 3-Respiratory Syncytial Virus-Mannheimia Haemolytica-Pasteurella Multocida Modified Live Virus, Avirulent Live Culture Vaccine (USDA: 11A8.22) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002008 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
47. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 11A5.20) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002009 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
48. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002010 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
49. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002011 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
50. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine (USDA: 11A1.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002012 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
51. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.20) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002013 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
52. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.26) |
a. Manufacturer: |
Pfizer, Inc. |
b. Vaccine Ontology ID: |
VO_0002014 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
53. Bovine Rhinotracheitis-Virus Diarrhea-Respiratory Syncytial Virus Modified Live Virus Vaccine-Leptospira Pomona Bacterin (USDA: 4367.30) |
a. Manufacturer: |
Heska Corporation |
b. Vaccine Ontology ID: |
VO_0002015 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
54. Bovine Virus Diarrhea-Respiratory Syncytial Virus Killed Virus Vaccine (USDA: 12A5.20) |
a. Manufacturer: |
Novartis Animal Health US, Inc. |
b. Vaccine Ontology ID: |
VO_0002028 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Cattle |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
55. BRSV DNA vaccine VCL-Fb |
a. Vaccine Ontology ID: |
VO_0004574 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Calves |
e. Gene Engineering of
F |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pVCL1012 (Taylor et al., 2005) |
g. Immunization Route |
Intramuscular injection (i.m.) |
h.
Cattle Response |
- Vaccine Immune Response Type:
VO_0003057
- Immune Response:
Seven days after BRSV challenge, BRSV-specific serum IgA titres in calves vaccinated i.m. with VCL-Fb were significantly greater than those in calves vaccinated by the i.d. route (P < 0.05) (Taylor et al., 2005).
- Efficacy:
Vaccination with DNA encoding the BRSV F protein can induce a significant reduction in BRSV excretion in young calves. At slaughter, 7 days after challenge, BRSV was isolated from the lungs of three out of four calves vaccinated with control plasmid, two out of six calves vaccinated i.d. with VCL-Fb, but none of the calves vaccinated i.m. with VCL-Fb (Taylor et al., 2005).
|
|
|
|
 |
|
 |
|
|
IV. References |
1. Blodörn et al., 2014: Blodörn K, Hägglund S, Fix J, Dubuquoy C, Makabi-Panzu B, Thom M, Karlsson P, Roque JL, Karlstam E, Pringle J, Eléouët JF, Riffault S, Taylor G, Valarcher JF. Vaccine safety and efficacy evaluation of a recombinant bovine respiratory syncytial virus (BRSV) with deletion of the SH gene and subunit vaccines based on recombinant human RSV proteins: N-nanorings, P and M2-1, in calves with maternal antibodies. PloS one. 2014; 9(6); e100392. [PubMed: 24945377].
2. Gershwin et al., 2017: Gershwin LJ, Behrens NE, McEligot HA, Carvallo-Chaigneau FR, Crum LT, Gunnarson BM, Corbeil LB. A recombinant subunit vaccine for bovine RSV and Histophilus somni protects calves against dual pathogen challenge. Vaccine. 2017; 35(15); 1954-1963. [PubMed: 28274639].
3. Merck Vet Manual: BRSV: Merck Veterinary Manual-Bovine Respiratory Syncytial Virus [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/121211.htm]
4. Schmidt et al., 2002: Schmidt U, Beyer J, Polster U, Gershwin LJ, Buchholz UJ. Mucosal immunization with live recombinant bovine respiratory syncytial virus (BRSV) and recombinant BRSV lacking the envelope glycoprotein G protects against challenge with wild-type BRSV. Journal of virology. 2002; 76(23); 12355-12359. [PubMed: 12414977].
5. Schrijver et al., 1997: Schrijver RS, Langedijk JP, Keil GM, Middel WG, Maris-Veldhuis M, Van Oirschot JT, Rijsewijk FA. Immunization of cattle with a BHV1 vector vaccine or a DNA vaccine both coding for the G protein of BRSV. Vaccine. 1997; 15(17-18); 1908-1916. [PubMed: 9413101].
6. Taylor et al., 2005: Taylor G, Bruce C, Barbet AF, Wyld SG, Thomas LH. DNA vaccination against respiratory syncytial virus in young calves. Vaccine. 2005; 23(10); 1242-1250. [PubMed: 15652666].
|