1. NCBI Taxonomy ID: |
38170 |
2. Disease: |
Viral Arthritis, Pale Bird Syndrome, Tenosynovitis |
3. Introduction |
Avian reoviruses, in the past, have been associated with viral arthritis/tenosynovitis, malabsorption syndrome, stunting/runting syndromes, enteric disease, immunosuppression, and respiratory disease. Recently, there have been reports from the field and isolations of reoviruses from chickens exhibiting neurological signs. In birds with the disease, varying degrees of lameness is a typical sign of the disease. Some birds may also be stunted in size. Avian reoviruses are widespread in nature and are known to cause viral arthritis and malabsortion / pale bird syndrome. However, recent field reports have associated the virus with neurological signs. Vaccination of breeder birds as well as strict biosecurity procedures can effectively reduce the effects of reoviruses on commercial poultry flocks (Avian Reovirus Infections). |
II. Vaccine Related Pathogen Genes |
1. sigma C protein |
-
Gene Name :
sigma C protein
-
Sequence Strain (Species/Organism) :
Avian Reovirus
-
NCBI Protein GI :
AAL83498
-
Other Database IDs :
CDD:113356
CDD:282382 CDD:305065 CDD:176481
-
Taxonomy ID :
177351
-
Protein Name :
sigma C protein
-
Protein pI :
4.56
-
Protein Weight :
32765.55
-
Protein Length :
387
-
Protein Note :
Reovirus sigma C capsid protein; pfam04582
-
Protein Sequence : Show Sequence
>AAL83498.1 sigma C protein [Avian reovirus GEL13b98M]
MEGLTPLQRREVVGLILSLTSSVSISSGDLIPLYERLSAIEKMCTTVNDSLGHLTSSVSEISARIDDLAE
TVRNTVTDLNNVQIRVTALQSSFDSLSSNVTTLSSSVSNQESQLATVSTSVNALSTNVSNLQSDVSSTAL
TVTSLGQRVEALESGAGSALTFISPLKVDGKSVLLDMDPYFCSERANLTSYSASAQLLQFQWFVRSEGGS
SDSIDMNVVAHCHGRRTDYLMSTHDSLTVTGNSVTLVFNMDYITTQGVDYARLVPCHGFQQATFPVDISF
TKDDATHSYQVYGAFAGPRIFKVTFSPGETSATNVRFLTVRTGIDT
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Wu et al., 2005)
|
III. Vaccine Information |
 |
|
 |
|
|
|
1. Avian Reovirus Killed Virus Vaccine (USDA: 1045.00) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001606 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
2. Avian Reovirus Killed Virus Vaccine (USDA: 1045.01) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001607 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
3. Avian Reovirus Killed Virus Vaccine (USDA: 1045.02) |
a. Manufacturer: |
Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0001608 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
4. Avian Reovirus Killed Virus Vaccine (USDA: 1045.30) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0001609 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
5. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.00) |
a. Manufacturer: |
Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0002075 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
6. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.01) |
a. Manufacturer: |
Intervet Inc., Lohmann Animal Health International, Biomune Company |
b. Vaccine Ontology ID: |
VO_0002076 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
7. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Killed Virus Vaccine (USDA: 12M5.40) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002078 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
8. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.11) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002077 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
9. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.43) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002081 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
10. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.50) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002082 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
11. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.90) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002083 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
12. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Mass Type, Killed Virus Vaccine (USDA: 12M5.91) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002084 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
13. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.41) |
a. Manufacturer: |
Lohmann Animal Health International, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002079 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
14. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass & Ark Types, Killed Virus Vaccine (USDA: 12M5.42) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002080 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
15. Bursal Disease-Newcastle Disease-Bronchitis-Reovirus Standard & Variant, Mass Type, Killed Virus Vaccine (USDA: 12M5.E0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002085 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
16. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.40) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002086 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
17. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.41) |
a. Manufacturer: |
Intervet Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002087 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
18. Bursal Disease-Newcastle Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12P5.E0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002088 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
19. Bursal Disease-Reovirus Killed Virus Vaccine (USDA: 12D5.02) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002056 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
20. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.01) |
a. Manufacturer: |
Merial, Inc., Biomune Company |
b. Vaccine Ontology ID: |
VO_0002055 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
21. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.03) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002057 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
22. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.04) |
a. Manufacturer: |
Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0002058 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
23. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.30) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002059 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
24. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.E0) |
a. Manufacturer: |
Biomune Company |
b. Vaccine Ontology ID: |
VO_0002061 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
25. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F0) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002062 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
26. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.F1) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002063 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
27. Bursal Disease-Reovirus Standard & Variant, Killed Virus Vaccine (USDA: 12D5.T0) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002064 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
28. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live & Modified Live Virus Vaccine (USDA: 16T1.00) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002146 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
29. Marek's Disease-Tenosynovitis Serotypes 2 & 3, Live Virus Vaccine (USDA: 16T1.03) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002147 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
30. Tenosynovitis Live Virus Vaccine (USDA: 1951.10) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001730 |
c. Type: |
Live vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
31. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.01) |
a. Manufacturer: |
Wyeth, Lohmann Animal Health International |
b. Vaccine Ontology ID: |
VO_0001731 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
32. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.02) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001732 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
33. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.03) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001733 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
34. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.04) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001734 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
35. Tenosynovitis Modified Live Virus Vaccine (USDA: 1951.11) |
a. Manufacturer: |
Wyeth, Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0001735 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
36. Tenosynovitis Modified Live Virus Vaccine (USDA: 1952.01) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0001736 |
c. Type: |
Live, attenuated vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Chicken |
|
|
|
 |
|
 |
|
|
IV. References |
1. Avian Reovirus Infections: Avian Reovirus Infections [http://www.thepoultrysite.com/articles/96/avian-reovirus-infections]
2. Wu et al., 2005: Wu H, Williams Y, Gunn KS, Singh NK, Locy RD, Giambrone JJ. Yeast-derived sigma C protein-induced immunity against avian reovirus. Avian diseases. 2005; 49(2); 281-284. [PubMed: 16094835].
|