VIOLIN: Vaccine Investigation and Online Information Network

Pseudomonas aeruginosa

Table of Contents

General Information
Vaccine Related Pathogen Genes
1. algE (Protective antigen)
2. flagellin (Protective antigen)
3. fliC (Protective antigen)
4. fliC (Protective antigen)
5. FliD (Protective antigen)
6. hcp1 (Protective antigen)
7. OprF (Protective antigen)
8. oprF_3 (Protective antigen)
9. OprI (Protective antigen)
10. oprL (Protective antigen)
11. PcrV (Protective antigen)
12. pilA (Protective antigen)
13. pilA (Protective antigen)
14. pilA (Protective antigen)
15. popB (Protective antigen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

287

2. Disease:

Pseudomonas aeruginosa infection

3. Introduction

Pseudomonas aeruginosa is member of the Gamma Proteobacteria class of Bacteria. It is a Gram-negative, aerobic rod belonging to the bacterial family Pseudomonadaceae. Since the revisionist taxonomy based on conserved macromolecules (e.g. 16S ribosomal RNA) the family includes only members of the genus Pseudomonas which are cleaved into eight groups. Pseudomonas aeruginosa is the type species of its group. which contains 12 other members. Pseudomonas aeruginosa is an opportunistic pathogen, meaning that it exploits some break in the host defenses to initiate an infection. In fact, Pseudomonas aeruginosa is the epitome of an opportunistic pathogen of humans. The bacterium almost never infects uncompromised tissues, yet there is hardly any tissue that it cannot infect if the tissue defenses are compromised in some manner. It causes urinary tract infections, respiratory system infections, dermatitis, soft tissue infections, bacteremia, bone and joint infections, gastrointestinal infections and a variety of systemic infections, particularly in patients with severe burns and in cancer and AIDS patients who are immunosuppressed. Pseudomonas aeruginosa infection is a serious problem in patients hospitalized with cancer, cystic fibrosis, and burns. The case fatality rate in these patients is near 50 percent (Textbook of Bacteriology).

4. Microbial Pathogenesis

P. aeruginosa infections are widely varied. The bacteria can colonize wounds and enter the blood stream, they can colonize the lungs, and they can also colonize the a scratched cornea. P. aeruginosa has a variety of virulence factors that contribute to its widely varied pathogenesis (Salyers and Whitt., 2002).

5. Host Ranges and Animal Models

Pseudomonas aeruginosa is an opportunistic human pathogen. The burned mouse model is used to model pseudomonas infection in burn patients. For lung infections guinea pig and rat models are used. C. elegans is also a model used to study host-pathogen interactions (Salyers and Whitt., 2002).

6. Host Protective Immunity

Most strains of P. aeruginosaare resistant to killing in serum alone, but the addition of polymorphonuclear leukocytes results in bacterial killing. Killing is most efficient in the presence of type-specific opsonizing antibodies, directed primarily at the antigenic determinants of LPS. This suggests that phagocytosis is an important defense and that opsonizing antibody is the principal functional antibody in protecting from P. aeruginosa infections. Once P. aeruginosa infection is established, other antibodies, such as antitoxin, may be important in controlling disease. Cell-mediated immunity does not seem to play a major role in resistance or defense against Pseudomonas infections (Textbook of Bacteriology).

II. Vaccine Related Pathogen Genes

1. algE

Gene Name : algE
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : NP_252234
Other Database IDs : CDD:315937
Taxonomy ID : 208964
Gene Strand (Orientation) : ?
Protein Name : alginate production protein AlgE
Protein pI : 4.64
Protein Weight : 53211.29
Protein Length : 574
Protein Note : Alginate export; pfam13372

Protein Sequence : Show Sequence

>NP_252234.1 alginate production protein AlgE [Pseudomonas aeruginosa PAO1]
MNSSRSVNPRPSFAPRALSLAIALLLGAPAFAANSGEAPKNFGLDVKITGESENDRDLGTAPGGTLNDIG
IDLRPWAFGQWGDWSAYFMGQAVAATDTIETDTLQSDTDDGNNSRNDGREPDKSYLAAREFWVDYAGLTA
YPGEHLRFGRQRLREDSGQWQDTNIEALNWSFETTLLNAHAGVAQRFSEYRTDLDELAPEDKDRTHVFGD
ISTQWAPHHRIGVRIHHADDSGHLRRPGEEVDNLDKTYTGQLTWLGIEATGDAYNYRSSMPLNYWASATW
LTGDRDNLTTTTVDDRRIATGKQSGDVNAFGVDLGLRWNIDEQWKAGVGYARGSGGGKDGEEQFQQTGLE
SNRSNFTGTRSRVHRFGEAFRGELSNLQAATLFGSWQLREDYDASLVYHKFWRVDDDSDIGTSGINAALQ
PGEKDIGQELDLVVTKYFKQGLLPASMSQYVDEPSALIRFRGGLFKPGDAYGPGTDSTMHRAFVDFIWRF

Molecule Role : Protective antigen
Molecule Role Annotation : Furthermore, we suggest to include AlgE in a multicomponent experimental vaccine for potential protection of non-colonized CF patients from colonization with mucoid P. aeruginosa.(Rehm et al., 1994)

2. flagellin

Gene Name : flagellin
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : CAA67105
Other Database IDs : CDD:279061
CDD:284584
CDD:224263
CDD:279090
GOA:P72127
HSSP: 1ORY
InterPro: IPR001029
InterPro: IPR001492
InterPro: IPR010810
UniProtKB/TrEMBL: P72127
Taxonomy ID : 287
Protein Name : flagellin
Protein pI : 4.36
Protein Weight : 67085.52
Protein Length : 767
Protein Note : Bacterial flagellin N-terminal helical region; pfam00669

Protein Sequence : Show Sequence

>CAA67105.1 flagellin, partial [Pseudomonas aeruginosa]
GLQIANRLTSQITGVNTAVKNANDGISIAQTAEGALQESTNILQRMRELSLQAANGSNSDEDRNSLNQEF
SALSKELTRIGSTTTFDTGMKLLDGSAGTLSFQVGANANENISFSLGKMDAASLKSTSDTASVVGGPQPN
SVLTSTLTQSASVVSTALVGTGSGSLGNVSINGVGVDLSSIADDDGAAAAKAINDSKAGVTATWDATAKT
ISLSSNKDIKLADVDAGALAKIGLTAGTTDAQISKTATQVGTALAGSGTANFADMAINGSSVALSSIKDN
DGAAAVKAINDAKISGVSASRDATTKKITLSSENSDLKVDGAAAGDLEKLGLGAASDTTKTTTAVIDYDD
VSINGHPIALNGKTSASDVVQEINKWTSNTGVTASIDDSGKLSLASKNGKIDFGNTNSLALDKLGVSSSA
KPTFALEKDTSFVLNGNEIKLSKGDSLDAVAQKINSAGLGVGAAVDNGKLVLNSYGADITLTDGGDKADK
WWAGSYRSDQGTTSATTTHAQGNVDLSNQGLAADGSININGTDISFKAGDKIDDVVSKINEQSQATGVSA
AKDAHGLLVLNSNSDFTLGVPTGAGATDATAALGLTAGTSIAQETSVAELDIKTAFDAQKSIQVIDSALK
QIDSQRAELGAVQNRFDSTISNLQSISENATSARSRVQDTDFAAETAEMTKQQTLQQASTAVLAQANQLP

Molecule Role : Protective antigen
Molecule Role Annotation : (Laghaei et al., 2016)

3. fliC

Gene Name : fliC
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : AAP34195
Other Database IDs : CDD:236344
Taxonomy ID : 287
Protein Name : FliC
Protein pI : 4.37
Protein Weight : 11293.39
Protein Length : 179
Protein Note : flagellin; Reviewed

Protein Sequence : Show Sequence

>AAP34195.1 FliC, partial [Pseudomonas aeruginosa]
NVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISYVSKAGKDGSGAITSAVSGVVIADTGSTGV
GTAAGVAPSATAFAKTNDTVAKIDISTAKGAQSAVLVIDEAIKQIDAQRADLGAV

Molecule Role : Protective antigen
Molecule Role Annotation :

4. fliC

Gene Name : fliC
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : AAB69135
Other Database IDs : CDD:279061
CDD:284584
CDD:279090
Taxonomy ID : 287
Protein Name : flagellin
Protein pI : 4.82
Protein Weight : 40421.39
Protein Length : 498
Protein Note : Bacterial flagellin N-terminal helical region; pfam00669

Protein Sequence : Show Sequence

>AAB69135.1 flagellin, partial [Pseudomonas aeruginosa]
GLQISNRLSNQISGLNVATRNANDGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEV
AAQQAELTRISDTTTFGGRKLLDGSFGTTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAGTVASVA
GTATASGIASGTVNLVGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVFTADVSGVTGGSLNFDV
TVGSNTVSLAGVTSTQDLADQLNSNSSKLGNTASINDKGVLTITSATGENVKFGAQTGTATAGQVAVKVQ
GSDGKFEAAAKNVVAAGTAATTTIVTGYVQLNSPTAYSVSGTGTQASQVFGNASAAQKSSVASVDISTAD
GAQNAIAVVDNALAAIDAQRADLSAVQNRFKNTIDNLTNISENATNARSRIKDTDFAAETAALSKNQVLQ
QAGTAILAQANQLP

Molecule Role : Protective antigen
Molecule Role Annotation : (Behrouz et al., 2016)

5. FliD

Gene Name : FliD
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : EAZ56903
Other Database IDs : CDD:224264
Taxonomy ID : 350703
Protein Name : flagellar cap; FliD
Protein pI : 7.1
Protein Weight : 47678.93
Protein Length : 548
Protein Note : Flagellar capping protein FliD [Cell motility]; COG1345

Protein Sequence : Show Sequence

>EAZ56903.1 flagellar cap; FliD [Pseudomonas aeruginosa 2192]
MANSTTINGYNSGLDIKNIVSTLVAAEKAPKEAQLKRLESDTTAKFTGIGQLKSAISDLQTILKELNKPE
LFQKRSASTSDEKFATATATKDALPGIYKLEVTQLASVSKVATASFADGYKTTSGGTLTIKQGADDAGVT
VNVAAGATLAEVRDSLNAQLKDKGITANIVNNPGDGTSRLVFTGKDSGAGKDVFVQGSSGLENFNIGSVG
ADGKLTLSQLDGSSSSSSGYITQAKNAKFSIDGLTLESPTNTVDKVINGVTFELKTVTDTNKPITISVEQ
DRGGVKDNIKKFVEAYNKLVGVTSELTGVTKVGDDKAPVVGALVGDSSVRNLLTTMRNEMVQPGQGTDVR
MLADMGITTKKDGTLEIDDKKLDKVLKDKFESVSALFTGDTGLMKRLDDKLTPYTQTGGVLQQRLDGLQD
TIKSVDTQREALNRRVEQLQDRLLKQFTAMDQLIGQLNQTSGRMAQALSSLPGLVKKS

Molecule Role : Protective antigen
Molecule Role Annotation :

6. hcp1

Gene Name : hcp1
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : ARG84223
Other Database IDs : CDD:310322
Taxonomy ID : 287
Protein Name : Hcp1
Protein pI : 7.66
Protein Weight : 16544.36
Protein Length : 208
Protein Note : Type VI secretion system effector, Hcp; pfam05638

Protein Sequence : Show Sequence

>ARG84223.1 Hcp1 [Pseudomonas aeruginosa]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPVKYGWNIRQNVQA

Molecule Role : Protective antigen
Molecule Role Annotation : (Yang et al., 2017)

7. OprF

Gene Name : OprF
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa PAO1
VO ID : VO_0012360
NCBI Gene ID : 878442
NCBI Protein GI : 15596974
Locus Tag : PA1777
Genbank Accession : AE004091
Protein Accession : NP_250468
Taxonomy ID : 208964
Gene Starting Position : 1921173
Gene Ending Position : 1922225
Gene Strand (Orientation) : +
Protein Name : outer membrane porin F
Protein pI : 4.75
Protein Weight : 34266.56
Protein Length : 350

DNA Sequence : Show Sequence

>NC_002516.2:1921173-1922225 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GATGAAACTGAAGAACACCTTAGGCGTTGTCATCGGCTCGCTGGTTGCCGCTTCGGCAATGAACGCCTTT
GCCCAGGGCCAGAACTCGGTAGAGATCGAAGCCTTCGGCAAGCGCTACTTCACCGACAGCGTTCGCAACA
TGAAGAACGCGGACCTGTACGGCGGCTCGATCGGTTACTTCCTGACCGACGACGTCGAGCTGGCGCTGTC
CTACGGTGAGTACCATGACGTTCGTGGCACCTACGAAACCGGCAACAAGAAGGTCCACGGCAACCTGACC
TCCCTGGACGCCATCTACCACTTCGGTACCCCGGGCGTAGGTCTGCGTCCGTACGTGTCGGCTGGTCTGG
CTCACCAGAACATCACCAACATCAACAGCGACAGCCAAGGCCGTCAGCAGATGACCATGGCCAACATCGG
CGCTGGTCTGAAGTACTACTTCACCGAGAACTTCTTCGCCAAGGCCAGCCTCGACGGCCAGTACGGTCTG
GAGAAGCGTGACAACGGTCACCAGGGCGAGTGGATGGCTGGCCTGGGCGTCGGCTTCAACTTCGGTGGTT
CGAAAGCCGCTCCGGCTCCGGAACCGGTTGCCGACGTTTGCTCCGACTCCGACAACGACGGCGTTTGCGA
CAACGTCGACAAGTGCCCGGATACCCCGGCCAACGTCACCGTTGACGCCAACGGCTGCCCGGCTGTCGCC
GAAGTCGTACGCGTACAGCTGGACGTGAAGTTCGACTTCGACAAGTCCAAGGTCAAAGAGAACAGCTACG
CTGACATCAAGAACCTGGCTGACTTCATGAAGCAGTACCCGTCCACTTCCACCACCGTTGAAGGTCACAC
CGACTCCGTCGGCACCGACGCTTACAACCAGAAGCTGTCCGAGCGTCGTGCCAACGCCGTTCGTGACGTA
CTGGTCAACGAGTACGGTGTAGAAGGTGGTCGCGTGAACGCTGTTGGTTACGGCGAGTCCCGCCCGGTTG
CCGACAACGCCACCGCTGAAGGCCGCGCTATCAACCGTCGCGTTGAAGCCGAAGTAGAAGCTGAAGCCAA
GTA

Protein Sequence : Show Sequence

>NP_250468.1 outer membrane porin F [Pseudomonas aeruginosa PAO1]
MKLKNTLGVVIGSLVAASAMNAFAQGQNSVEIEAFGKRYFTDSVRNMKNADLYGGSIGYFLTDDVELALS
YGEYHDVRGTYETGNKKVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIG
AGLKYYFTENFFAKASLDGQYGLEKRDNGHQGEWMAGLGVGFNFGGSKAAPAPEPVADVCSDSDNDGVCD
NVDKCPDTPANVTVDANGCPAVAEVVRVQLDVKFDFDKSKVKENSYADIKNLADFMKQYPSTSTTVEGHT
DSVGTDAYNQKLSERRANAVRDVLVNEYGVEGGRVNAVGYGESRPVADNATAEGRAINRRVEAEVEAEAK

Molecule Role : Protective antigen
Molecule Role Annotation : The oprF gene was cloned into plasmid vector pVR1020, and the plasmid vaccines were delivered to mice by biolistic (gene gun) intradermal inoculation. Following the initial immunization and two consecutive boosts, each at 2-week intervals, protection was demonstrated in a mouse model of chronic pulmonary infection by P. aeruginosa. Eight days postchallenge, both lungs were removed and examined. A significant reduction in the presence of severe macroscopic lesions, as well as in the number of bacteria present in the lungs, was seen (Price et al., 2001).
Our data showed that mice immunized with OprF/OprI or OprF/OprI and flagellin B are significantly protected from infection caused by mucoid and nonmucoid strains of P. aeruginosa.(Hassan et al., 2018).
Related Vaccine(s): P. aeruginosa DNA Vaccine encoding OprF , P. aeruginosa DNA vaccine pGACAG-OprF/OprI , P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA

8. oprF_3

Gene Name : oprF_3
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : CRR17034
Taxonomy ID : 287
Protein Name : Outer membrane porin F precursor
Protein pI : 4.63
Protein Weight : 37391.91
Protein Length : 440

Protein Sequence : Show Sequence

>CRR17034.1 Outer membrane porin F precursor [Pseudomonas aeruginosa]
MNKKILTAALLGGLAFAQAASAQEFDDRWYLTGSAGFNFQDSDRLTNDAPFVTLGLGKFISPNWSLDGEL
NYQNPNFDSNQDLNWSQYGVSLDLRRHFIKEGRGWNPYIVGGLGYQKSEEEYAALDNNGPRQRKDGNVAA
KLGVGLQTTFEKRVAVRAEVAYRADFDDQSIAARDESWFGDVLASVGVVIPLGPAPVAAAPAPAPVAPSC
ADLDDDGDGVNNCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSNLRPDAVAILSEATEILKRYP
DLRVEVAGHTDSKGTDAYNQKLSERRATAVYNYLTKNGVDAGRLVGPIGYGESRPIAPNTNPDGSDNPEG
RAKNRRTELNVQN

Molecule Role : Protective antigen
Molecule Role Annotation : (Ahmadi et al., 2012)

9. OprI

Gene Name : OprI
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa PAO1
VO ID : VO_0012362
NCBI Gene ID : 879851
NCBI Protein GI : 15598049
Locus Tag : PA2853
Genbank Accession : AE004091
Protein Accession : NP_251543
Taxonomy ID : 208964
Gene Starting Position : 3206914
Gene Ending Position : 3207165
Gene Strand (Orientation) : +
Protein Name : outer membrane lipoprotein OprI
Protein pI : 8.51
Protein Weight : 8635.98
Protein Length : 83

DNA Sequence : Show Sequence

>NC_002516.2:3206914-3207165 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GATGAACAACGTTCTGAAATTCTCTGCTCTGGCTCTGGCTGCTGTTCTGGCCACCGGTTGCAGCAGCCAC
TCCAAAGAAACCGAAGCTCGTCTGACCGCTACCGAAGACGCAGCTGCTCGTGCTCAGGCTCGCGCTGACG
AAGCCTATCGCAAGGCTGACGAAGCTCTGGGCGCTGCTCAGAAAGCTCAGCAGACTGCTGACGAGGCTAA
CGAGCGTGCCCTGCGCATGCTGGAAAAAGCCAGCCGCAAGTA

Protein Sequence : Show Sequence

>NP_251543.1 outer membrane lipoprotein OprI [Pseudomonas aeruginosa PAO1]
MNNVLKFSALALAAVLATGCSSHSKETEARLTATEDAAARAQARADEAYRKADEALGAAQKAQQTADEAN
ERALRMLEKASRK

Molecule Role : Protective antigen
Molecule Role Annotation : Recombinant OprI protein was used to immunize mice, and was found to be protective against a challenge with a four- to fivefold 50% lethal dose of P. aeruginosa (Finke et al., 1990).
Our data showed that mice immunized with OprF/OprI are significantly protected from infection caused by mucoid and nonmucoid strains of P. aeruginosa.(Hassan et al., 2018)
Related Vaccine(s): P. aeruginosa DNA vaccine pGACAG-OprF/OprI , P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA , P. aeruginosa OprI Protein Vaccine

10. oprL

Gene Name : oprL
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : ABX84373
Other Database IDs : CDD:225439
CDD:274307
CDD:143586
Taxonomy ID : 287
Protein Name : OprL
Protein pI : 6.27
Protein Weight : 17004.392
Protein Length : 214
Protein Note : Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins [Cell wall/membrane/envelope biogenesis]; COG2885

Protein Sequence : Show Sequence

>ABX84373.1 OprL [Pseudomonas aeruginosa]
MEMLKFGKFAALALAMAVAVGCSSKGGDASGEGANGGVDPNAGYGANSGAVDGSLSDEAALRAITTFYFE
YDSSDLKPEAMRALDVHAKDLKGSGQRVVLEGHTDERGTREYNMALGERRAKAVQRYLVLQGVSPATLEL
VSYGKERPVATGHDEQSWAQNRRVELKK

Molecule Role : Protective antigen
Molecule Role Annotation : (Soldatenkova et al., 2013)

11. PcrV

Gene Name : PcrV
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa PAO1
VO ID : VO_0012361
NCBI Gene ID : 882997
NCBI Protein GI : 15596903
Locus Tag : PA1706
Genbank Accession : AE004091
Protein Accession : NP_250397
Taxonomy ID : 208964
Gene Starting Position : 1852287
Gene Ending Position : 1853171
Gene Strand (Orientation) : +
Protein Name : type III secretion protein PcrV
Protein pI : 4.77
Protein Weight : 30496.99
Protein Length : 294

DNA Sequence : Show Sequence

>NC_002516.2:1852287-1853171 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GATGGAAGTCAGAAACCTTAATGCCGCTCGCGAGCTGTTCCTGGACGAGCTCCTGGCCGCGTCGGCGGCG
CCTGCCAGTGCCGAGCAGGAGGAACTGCTGGCCCTGTTGCGCAGCGAGCGGATCGTGCTGGCCCACGCCG
GCCAGCCGCTGAGCGAGGCGCAAGTGCTCAAGGCGCTCGCCTGGTTGCTCGCGGCCAATCCGTCCGCGCC
TCCGGGGCAGGGCCTCGAGGTACTCCGCGAAGTCCTGCAGGCACGTCGGCAGCCCGGTGCGCAGTGGGAT
CTGCGCGAGTTCCTGGTGTCGGCCTATTTCAGCCTGCACGGGCGTCTCGACGAGGATGTCATCGGTGTCT
ACAAGGATGTCCTGCAGACCCAGGACGGCAAGCGCAAGGCGCTGCTCGACGAGCTCAAGGCGCTGACCGC
GGAGTTGAAGGTCTACAGCGTGATCCAGTCGCAGATCAACGCCGCGCTGTCGGCCAAGCAGGGCATCAGG
ATCGACGCTGGCGGTATCGATCTGGTCGACCCCACGCTATATGGCTATGCCGTCGGCGATCCCAGGTGGA
AGGACAGCCCCGAGTATGCGCTGCTGAGCAATCTGGATACCTTCAGCGGCAAGCTGTCGATCAAGGATTT
TCTCAGCGGCTCGCCGAAGCAGAGCGGGGAACTCAAGGGCCTCAGCGATGAGTACCCCTTCGAGAAGGAC
AACAACCCGGTCGGCAATTTCGCCACCACGGTGAGCGACCGCTCGCGTCCGCTGAACGACAAGGTCAACG
AGAAGACCACCCTGCTCAACGACACCAGCTCCCGCTACAACTCGGCGGTCGAGGCGCTCAACCGCTTCAT
CCAGAAATACGACAGCGTCCTGCGCGACATTCTCAGCGCGATCTA

Protein Sequence : Show Sequence

>NP_250397.1 type III secretion protein PcrV [Pseudomonas aeruginosa PAO1]
MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAP
PGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTA
ELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDF
LSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFI
QKYDSVLRDILSAI

Molecule Role : Protective antigen
Molecule Role Annotation : Burned Pseudomonas aeruginosa-infected mice immunized against PcrV, a type III virulence system translocating protein, showed significantly enhanced survival compared to controls (Holder et al., 2001).
The results clearly show that, with PcrV as the vaccine antigen, all three adjuvants tested, FA, alum and CpG ODN, were effective in inducing protective immunity against infection with P. aeruginosa. (Hamaoka et al., 2017)
Related Vaccine(s): P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA , P. aeruginosa DNA vaccine pGACAG-PcrV , P. aeruginosa PcrV Protein Vaccine

12. pilA

Gene Name : pilA
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa PAO1
NCBI Protein GI : 15599721
Other Database IDs : CDD:227304
Taxonomy ID : 208964
Gene Strand (Orientation) : ?
Protein Name : type 4 fimbrial protein PilA
Protein pI : 6.59
Protein Weight : 15164.05
Protein Length : 225
Protein Note : Tfp pilus assembly protein, major pilin PilA [Cell motility, Extracellular structures]; COG4969

Protein Sequence : Show Sequence

>NP_253215.1 type 4 fimbrial protein PilA [Pseudomonas aeruginosa PAO1]
MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGSKIKIGT
TASTATETYVGVEPDANKLGVIAVAIEDSGAGDITFTFQTGTSSPKNATKVITLNRTADGVWACKSTQDP
MFTPKGCDN

Molecule Role : Protective antigen
Related Vaccine(s): P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA

13. pilA

Gene Name : pilA
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : AAK68046
Other Database IDs : CDD:227304
CDD:278540
Taxonomy ID : 287
Protein Name : PilA
Protein pI : 9.39
Protein Weight : 15824.84
Protein Length : 200
Protein Note : Tfp pilus assembly protein, major pilin PilA [Cell motility, Extracellular structures]; COG4969

Protein Sequence : Show Sequence

>AAK68046.1 PilA [Pseudomonas aeruginosa]
MKAQKGFYLIELMIVVAIIGILAAIAIPQYQDYTARTQVTRAVSEISALKTAAESAILEGKKLVSNDSPK
NDEYDLGFTSSTLLTGSGKGQIKIDKADTATPEISGTLGGSSGKGIAGAVITVKRDDKGVWTCGITGSPT
NWKANYAPANCPKS

Molecule Role : Protective antigen
Molecule Role Annotation : (Korpi et al., 2015)

14. pilA

Gene Name : pilA
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : AAC60462
Other Database IDs : CDD:227304
CDD:290278
CDD:278540
Taxonomy ID : 287
Protein Name : pilin
Protein pI : 8.02
Protein Weight : 14904.71
Protein Length : 197
Protein Note : Tfp pilus assembly protein, major pilin PilA [Cell motility, Extracellular structures]; COG4969

Protein Sequence : Show Sequence

>AAC60462.1 pilin [Pseudomonas aeruginosa]
MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGENIKIGS
QASTADTTYVGVDATANKLGTIAVTIGNNGAGTVTFTFAAGNSSPKNSGAIITLTRTDAGSWACTSTQDE
MFIPKGCKAP

Molecule Role : Protective antigen
Molecule Role Annotation : (Banadkoki et al., 2016)

15. popB

Gene Name : popB
Sequence Strain (Species/Organism) : Pseudomonas aeruginosa
NCBI Protein GI : AAC45937
Other Database IDs : CDD:227900
CDD:279450
Taxonomy ID : 287
Protein Name : PopB
Protein pI : 5.88
Protein Weight : 37740.4
Protein Length : 441
Protein Note : Uncharacterized protein [Function unknown]

Protein Sequence : Show Sequence

>AAC45937.1 PopB [Pseudomonas aeruginosa]
MNPITLERAGLPYGVADAGDIPALGRPVARDVESLRVERLAAPAAASASGTGVALTPPSAASQQRLEVAN
RAEIASLVQAVGEDVGLARQVVLAGASTLLSAGLMSPQAFEIELAKITGEVENQQKKLKLTEIEQARKQN
LQKMEDNQQKIRESEEAAKEAQKSGLAAKIFGWISAIASIIVGAIMVATGVGAAAGALMIAGGVMGVVSQ
SVQQAAADGLISKEVMEKLGPALMGIEIAVALLAAVVSFGGSAVGGLARLGAKIGGKAAEMTASLASKVA
DLGGKFGSLAGQSLSHSLKLGVQVSDLTLDVANGAAQATHSGFQAKAANRQADVQESRADLTTLQGVIER
LKEELSRMCMLEAFQEIMERIFAMLQAKGETLHNLSSRPAAI

Molecule Role : Protective antigen
Molecule Role Annotation : (Wu et al., 2012)

III. Vaccine Information

1. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.20)

a. Manufacturer:

Intervet Inc.

b. Vaccine Ontology ID:

VO_0001834

c. Type:

Live, attenuated vaccine; Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Carnivores

2. Mink Distemper-Enteritis Modified Live & Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 4949.31)

a. Manufacturer:

United Vaccines, Inc.

b. Vaccine Ontology ID:

VO_0001835

c. Type:

Live, attenuated vaccine; Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Carnivores

3. Mink Enteritis Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 49A5.20)

a. Manufacturer:

Intervet Inc.

b. Vaccine Ontology ID:

VO_0001839

c. Type:

Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Carnivores

4. Mink Enteritis Killed Virus Vaccine-Clostridium Botulinum Type C-Pseudomonas Aeruginosa Bacterin-Toxoid (USDA: 49A5.21)

a. Manufacturer:

United Vaccines, Inc.

b. Vaccine Ontology ID:

VO_0001840

c. Type:

Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Carnivores

5. P. aeruginosa DNA Vaccine encoding OprF

a. Vaccine Ontology ID:

VO_0004189

b. Type:

DNA vaccine

c. Status:

Research

d. Antigen

The pVR1020/oprF plasmid.

e. Gene Engineering of OprF

Type: DNA vaccine construction
Description: The 977-bp oprF gene was cloned from P. aeruginosa PAO1 genomic DNA into the eukaryotic expression plasmid pVR1020 (Price et al., 2001).
Detailed Gene Information: Click here.

f. Vector:

pVR1020

g. Immunization Route

abdomen gene gun

h. Mouse Response

Host Strain: Pathogen Free ICR
Vaccination Protocol: At 14-day intervals, groups of 30 mice were inoculated a total of three times in the abdomen via biolistic particle injection (Helios Gene Gun kit; Bio-Rad, Richmond, Calif.) on days 0, 14, and 28 with 2 μg of either pVR1020 (control) or pVR1020/oprF, which was used to coat 1-μm-diameter gold beads (Price et al., 2001).
Challenge Protocol: Two weeks after the final immunization, the mice were challenged with agar beads containing the P. aeruginosa FD immunotype 4 strain. The mice were first anesthetized with an intraperitoneal injection of sodium pentobarbital and then inoculated via a tracheal incision with 50 μl of an agar bead slurry encasing approximately 7 × 10^2 CFU of P. aeruginosa (Price et al., 2001).
Efficacy: A significant reduction in the presence of severe macroscopic lesions, as well as in the number of bacteria present in the lungs, was seen in immunized mice (Price et al., 2001).
Description: The immunoprotective potential of the pVR1020/oprF vaccine was tested in a mouse model of chronic pulmonary infection (Price et al., 2001).

6. P. aeruginosa DNA vaccine pGACAG-OprF/OprI

a. Vaccine Ontology ID:

VO_0004570

b. Type:

DNA vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Mouse

e. Gene Engineering of OprF

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

f. Gene Engineering of OprI

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

g. Vector:

pGACAG (Saha et al., 2006)

h. Immunization Route

intramuscular electroporation

i. Mouse Response

Vaccine Immune Response Type: VO_0003057
Efficacy: Monovalent DNA vaccination targeting OprF/OprI could protect 80% of mice 4 days p.i. On the other hand, 70% of mice immunized with the control plasmid, PilA vaccine, or multivalent vaccine via GG were dead within 5 days p.i. (p < 0.01) (Saha et al., 2006).

7. P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA

a. Vaccine Ontology ID:

VO_0004572

b. Type:

DNA vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Mouse

e. Gene Engineering of OprF

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

f. Gene Engineering of OprI

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

g. Gene Engineering of PcrV

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

h. Gene Engineering of pilA

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

i. Vector:

pGACAG (Saha et al., 2006)

j. Immunization Route

intramuscular electroporation

k. Mouse Response

Vaccine Immune Response Type: VO_0003057
Efficacy: All mice vaccinated with multivalent DNA via imEPT survived for more than 10 days p.i. with PAK. On the other hand, 70% of mice immunized with the control plasmid, PilA vaccine, or multivalent vaccine via GG were dead within 5 days p.i. (p < 0.01) (Saha et al., 2006).

8. P. aeruginosa DNA vaccine pGACAG-PcrV

a. Vaccine Ontology ID:

VO_0004571

b. Type:

DNA vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Mouse

e. Gene Engineering of PcrV

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

f. Vector:

pGACAG (Saha et al., 2006)

g. Immunization Route

intramuscular electroporation

h. Mouse Response

Vaccine Immune Response Type: VO_0003057
Efficacy: Monovalent DNA vaccination targeting PcrV could protect 80% of mice 4 days p.i. On the other hand, 70% of mice immunized with the control plasmid, PilA vaccine, or multivalent vaccine via GG were dead within 5 days p.i. (p < 0.01) (Saha et al., 2006).

9. P. aeruginosa OprI Protein Vaccine

a. Vaccine Ontology ID:

VO_0004190

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

Recombinant OprI protein

e. Gene Engineering of OprI

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000127
Description: 100 μl of 1.5% Al(OH)3 (Finke et al., 1990).

g. Immunization Route

Intraperitoneal injection (i.p.)

h. Mouse Response

Host Strain: BALB/c
Vaccination Protocol: Female BALB/c mice, 12 to 16 weeks old, received 100 μl (27 ,ug) of OprI suspended in 100 μl of 1.5% Al(OH)3 intraperitoneally on days 0, 14, 35, and 63. Controls received Al(OH)3 only (Finke et al., 1990).
Challenge Protocol: mice were challenged intraperitoneally 10 days after the last immunization with 200 μl of a P. aeruginosa serogroup 6 suspension. Mice vaccinated with recombinant OprI received 6 x 10^6 to 1 x 10^8 living organisms each. (Finke et al., 1990).
Efficacy: Recombinant OprI protein was used to immunize mice, and was found to be protective against a challenge with a four- to fivefold 50% lethal dose of P. aeruginosa (Finke et al., 1990).

10. P. aeruginosa PcrV Protein Vaccine

a. Vaccine Ontology ID:

VO_0004191

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

PcrV

e. Gene Engineering of PcrV

Type: Recombinant protein preparation
Description: PcrV was produced as a lipopolysaccharide-free histidine-tagged infusion protein in pET16b and was purified by nickel chromatography (Holder et al., 2001).
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000142
Description: 0.1 ml of incomplete Freund's adjuvant (Holder et al., 2001).

g. Immunization Route

Intramuscular injection (i.m.)

h. Mouse Response

Host Strain: CF-1
Vaccination Protocol: On day 0, groups of 10 female CF-1 mice weighing 22 to 25 g were immunized intramuscularly in the hind leg (10 μg of immunogen in 0.1 ml of incomplete Freund's adjuvant), followed by a booster dose (10 μg in saline) without adjuvant on day 14 (Holder et al., 2001).
Challenge Protocol: Using the burned mouse model, mice were challenged by one of three strains of P. aeruginosa (Holder et al., 2001).
Efficacy: Burned Pseudomonas aeruginosa-infected mice immunized against PcrV, a type III virulence system translocating protein, showed significantly enhanced survival compared to controls (Holder et al., 2001).

11. SL3261-P. aeruginosa serogroup O11 O antigen

a. Vaccine Ontology ID:

VO_0004674

b. Type:

Recombinant vector vaccine

c. Status:

Research

d. Host Species for Licensed Use:

Baboon

e. Preparation

Attenuated Salmonella enterica serovar Typhimurium SL3261 expressing P. aeruginosa serogroup O11 O antigen (DiGiandomenico et al., 2004).

f. Immunization Route

Intramuscular injection (i.m.)

g. Mouse Response

Vaccination Protocol: For oral vaccination, mice were fed 100 μl of either PBS or the Salmonella vector and vaccine strains (1 × 10^9 to 5 × 10^9 CFU) by intragastric gavage. Oral inoculation was repeated once per week for a total of 4 weeks. For i.p. vaccination, mice were inoculated with a single dose of either PBS or each Salmonella strain (10^6 CFU) (DiGiandomenico et al., 2004).
Vaccine Immune Response Type: VO_0003057
Challenge Protocol: Mice were challenged with P. aeruginosa strains 9882-80 (serogroup O11) and 6294 (serogroup O6) (DiGiandomenico et al., 2004).
Efficacy: Orally vaccinated mice with an O11 strain (9882-80) at 6 and 12 times the 50% lethal dose showed increased survival in mice that received the vaccine compared to phosphate-buffered saline (PBS)- and vector-treated controls; no difference in survival was seen with a heterologous strain, 6294 (serogroup O6). In addition, significant protection against 9882-80 was not observed in i.p. vaccinated animals (DiGiandomenico et al., 2004).

IV. References

1. Ahmadi et al., 2012: Ahmadi H, Tabaraie B, Maleknia S, Pormirzagholi F, Nejati M, Hedayati MH. Immunological evaluation of OMP-F of native Iranian Pseudomonas aeruginosa as a protective vaccine. Journal of infection in developing countries. 2012; 6(10); 721-726. [PubMed: 23103894].

2. Banadkoki et al., 2016: Banadkoki AZ, Keshavarzmehr M, Afshar Z, Aleyasin N, Fatemi MJ, Behrouz B, Hashemi FB. Protective effect of pilin protein with alum+naloxone adjuvant against acute pulmonary Pseudomonas aeruginosa infection. Biologicals : journal of the International Association of Biological Standardization. 2016; 44(5); 367-373. [PubMed: 27427517].

3. Behrouz et al., 2016: Behrouz B, Mahdavi M, Amirmozafari N, Fatemi MJ, Irajian G, Bahroudi M, Hashemi FB. Immunogenicity of Pseudomonas aeruginosa recombinant b-type fagellin as a vaccine candidate: Protective efficacy in a murine burn wound sepsis model. Burns : journal of the International Society for Burn Injuries. 2016; ; . [PubMed: 27156804].

4. Campod�nico et al., 2010: Campod�nico VL, Llosa NJ, Grout M, D�ring G, Maira-Litr�n T, Pier GB. Evaluation of flagella and flagellin of Pseudomonas aeruginosa as vaccines. Infection and immunity. 2010; 78(2); 746-755. [PubMed: 19995892].

5. Finke et al., 1990: Finke M, Duchêne M, Eckhardt A, Domdey H, von Specht BU. Protection against experimental Pseudomonas aeruginosa infection by recombinant P. aeruginosa lipoprotein I expressed in Escherichia coli. Infection and immunity. 1990; 58(7); 2241-2244. [PubMed: 2114360].

6. Hamaoka et al., 2017: Hamaoka S, Naito Y, Katoh H, Shimizu M, Kinoshita M, Akiyama K, Kainuma A, Moriyama K, Ishii KJ, Sawa T. Efficacy comparison of adjuvants in PcrV vaccine against Pseudomonas aeruginosa pneumonia. Microbiology and immunology. 2017; 61(2); 64-74. [PubMed: 28370521].

7. Hassan et al., 2018: Hassan R, El-Naggar W, Abd El-Aziz AM, Shaaban M, Kenawy HI, Ali YM. Immunization with outer membrane proteins (OprF and OprI) and flagellin B�protects mice from pulmonary infection with mucoid and nonmucoid Pseudomonas aeruginosa. Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi. 2018; 51(3); 312-320. [PubMed: 28291719].

8. Holder et al., 2001: Holder IA, Neely AN, Frank DW. PcrV immunization enhances survival of burned Pseudomonas aeruginosa-infected mice. Infection and immunity. 2001; 69(9); 5908-5910. [PubMed: 11500471].

9. Korpi et al., 2015: Korpi F, Irajian G, Mahadavi M, Motamedifar M, Mousavi M, Laghaei P, Raei N, Behrouz B. Active Immunization with Recombinant PilA protein Protects Against Pseudomonas aeruginosa Infection in a Mouse Burn Wound Model. Journal of microbiology and biotechnology. 2015; ; . [PubMed: 26387817].

10. Laghaei et al., 2016: Laghaei P, Hashemi FB, Irajian G, Korpi F, Amirmozafari N, Behrouz B. Immunogenicity and protective efficacy of Pseudomonas aeruginosa type a and b flagellin vaccines in a burned mouse model. Molecular immunology. 2016; 74; 71-81. [PubMed: 27152476].

11. Price et al., 2001: Price BM, Galloway DR, Baker NR, Gilleland LB, Staczek J, Gilleland HE Jr. Protection against Pseudomonas aeruginosa chronic lung infection in mice by genetic immunization against outer membrane protein F (OprF) of P. aeruginosa. Infection and immunity. 2001; 69(5); 3510-3515. [PubMed: 11292786].

12. Rehm et al., 1994: Rehm BH, Grabert E, Hein J, Winkler UK. Antibody response of rabbits and cystic fibrosis patients to an alginate-specific outer membrane protein of a mucoid strain of Pseudomonas aeruginosa. Microbial pathogenesis. 1994; 16(1); 43-51. [PubMed: 8057826].

13. Saha et al., 2006: Saha S, Takeshita F, Sasaki S, Matsuda T, Tanaka T, Tozuka M, Takase K, Matsumoto T, Okuda K, Ishii N, Yamaguchi K, Klinman DM, Xin KQ, Okuda K. Multivalent DNA vaccine protects mice against pulmonary infection caused by Pseudomonas aeruginosa. Vaccine. 2006; 24(37-39); 6240-6249. [PubMed: 16806598].

14. Salyers and Whitt., 2002: Abigail A. Salyers, Dixie D. Whitt. Pseudomonas aeruginosa and Related Species, a Lesson in Versatility. 247-62. Bacterial Pathogenesis: A Molecular Approach. 2002. ASM Press, Washington D.C. USA.

15. Soldatenkova et al., 2013: Soldatenkova AV, Ge?derova LA, Akhmatova NK, Mikha?lova NA. [Pseudomonas aeruginosa recombinant proteins: effect on mice cytokine profile]. Zhurnal mikrobiologii, epidemiologii, i immunobiologii. 2013; (6); 80-87. [PubMed: 24605680].

16. Textbook of Bacteriology: Pseudomonas [http://www.textbookofbacteriology.net/pseudomonas.html]

17. Thomas et al., 2009: Thomas LD, Cripps AW, Kyd JM. Immune response mechanisms against Pseudomonas aeruginosa associated with mucosal immunization with protein antigens in a rat model of acute lung infection. Vaccine. 2009; 27(25-26); 3324-3330. [PubMed: 19200832].

18. Wu et al., 2012: Wu W, Huang J, Duan B, Traficante DC, Hong H, Risech M, Lory S, Priebe GP. Th17-stimulating protein vaccines confer protection against Pseudomonas aeruginosa pneumonia. American journal of respiratory and critical care medicine. 2012; 186(5); 420-427. [PubMed: 22723292].

19. Yang et al., 2017: Yang F, Gu J, Yang L, Gao C, Jing H, Wang Y, Zeng H, Zou Q, Lv F, Zhang J. Protective Efficacy of the Trivalent Pseudomonas aeruginosa Vaccine Candidate PcrV-OprI-Hcp1 in Murine Pneumonia and Burn Models. Scientific reports. 2017; 7(1); 3957. [PubMed: 28638106].

20. Zaidi et al., 2006: Zaidi TS, Priebe GP, Pier GB. A live-attenuated Pseudomonas aeruginosa vaccine elicits outer membrane protein-specific active and passive protection against corneal infection. Infection and immunity. 2006; 74(2); 975-983. [PubMed: 16428743].