VIOLIN: Vaccine Investigation and Online Information Network

Borrelia burgdorferi

Table of Contents

General Information
Vaccine Related Pathogen Genes
1. BmpA (Protective antigen)
2. BmpB (Protective antigen)
3. BmpD (Protective antigen)
4. Borrelia Burgdorferi Outer Surface Lipoprotein Bba64 (Protective antigen)
5. DbpA (Protective antigen)
6. dbpA (Protective antigen)
7. OspA (Protective antigen)
8. OspB (Protective antigen)
9. OspC (Protective antigen)
10. revA (Protective antigen)
11. vraA (Protective antigen)
12. fla (Virmugen)
Vaccine Information
References

I. General Information

1. NCBI Taxonomy ID:

139

2. Disease:

Lyme Disease

3. Introduction

Borrelia burgdorferi is a species of Gram negative bacteria of the spirochete class of the genus Borrelia. B. burgdorferi is predominant in North America, but also exists in Europe, and is the agent of Lyme disease. It is a zoonotic, vector-borne disease transmitted by ticks and is named after the researcher Willy Burgdorfer who first isolated the bacterium in 1982. B. burgdorferi is one of the few pathogenic bacteria that can survive without iron, having replaced all of its iron-sulfur cluster enzymes with enzymes that use manganese, thus avoiding the problem many pathogenic bacteria face in acquiring iron (Wiki: B. burgdorferi).

4. Microbial Pathogenesis

B. burgdorferi is deposited in skin lesions left by Ixodes ticks, and can then invade the bloodstream leading to dissemination throughout the body and cause problems in joints and nervous tissues (Salyers and Whitt., 2002).

5. Host Ranges and Animal Models

White footed mouse are the reservoir of B. burgdorferi. The bacteria are carried by ticks which vector the bacteria to other hosts such as humans, as well as small mammals such as voles and shrews. Animal models include rabbits, mice and dogs (Salyers and Whitt., 2002).

6. Host Protective Immunity

In most people B. burgdorferi is cleared from the bloodstream via antibodies and phagocytic cells (Salyers and Whitt., 2002).

II. Vaccine Related Pathogen Genes

1. BmpA

Gene Name : BmpA
Sequence Strain (Species/Organism) : Borrelia burgdorferi N40
NCBI Protein GI : AAG00584
Other Database IDs : CDD:280728
CDD:107349
Taxonomy ID : 521007
Protein Name : BmpA
Protein pI : 4.93
Protein Weight : 35653.94
Protein Length : 392
Protein Note : ABC transporter substrate-binding protein PnrA-like; pfam02608

Protein Sequence : Show Sequence

>AAG00584.1 BmpA [Borreliella burgdorferi N40]
MNKILLLILLESIVFLSCSGKGSLGSEIPKVSLIIDGTFDDKSFNESALNGVKKVKEEFKIELVLKESSS
NSYLSDLEGLKDAGSDLIWLIGYRFSDVAKVAALQNPDMKYAIIDPIYSNDPIPANLVGMTFRAQEGAFL
TGYIAARLSKTGKIGFLGGIEGEIVDAFRYGYEAGAKYANKDIKIFTQYIGSFADLEAGRSVATRMYSDE
IDIIHHAAGLGGIGAIEVAKELGSGHYIIGVDEDQAYLAPDNVITSTTKDVGRALNIFTSNHLKTNTFEG
GKLINYGLKEGVVGFVRNPKMISFELEKEIDNLSSKIINKEIIVPSNKESYEKFLKEFI

Molecule Role : Protective antigen
Molecule Role Annotation : (Bryksin et al., 2005)

2. BmpB

Gene Name : BmpB
Sequence Strain (Species/Organism) : Borrelia burgdorferi N40
NCBI Protein GI : AAG00585
Other Database IDs : CDD:299141
Taxonomy ID : 521007
Protein Name : BmpB
Protein pI : 6.52
Protein Weight : 8477.98
Protein Length : 138
Protein Note : Type 1 periplasmic binding fold superfamily; cl10011

Protein Sequence : Show Sequence

>AAG00585.1 BmpB, partial [Borreliella burgdorferi N40]
MRIVIFIFGILLTSCFSRNGIESSSKKIKISMLVDGVLDDKSFNSSANEALLRLKKDFPENIEEVFSCAI
SGVYSSYVS

Molecule Role : Protective antigen
Molecule Role Annotation : (Bryksin et al., 2005)

3. BmpD

Gene Name : BmpD
Sequence Strain (Species/Organism) : Borrelia burgdorferi N40
NCBI Protein GI : AAG00582
Other Database IDs : CDD:280728
CDD:107349
Taxonomy ID : 521007
Protein Name : BmpD
Protein pI : 5.08
Protein Weight : 34939.76
Protein Length : 394
Protein Note : ABC transporter substrate-binding protein PnrA-like; pfam02608

Protein Sequence : Show Sequence

>AAG00582.1 BmpD [Borreliella burgdorferi N40]
MLKKVYYFLIFLFIVACSSSDDGKSGAKTVSLIVDGAFDDKGFNESSSKAIRKLKADLNINIIEKASTGN
SYLGDIANLEDGNSNLIWGIGFRLSDILFQRASENVSVNYAIIEGVYDEIQIPKNLLNISFRSEEVAFLA
GYFASKASKTGKIGFVGGVRGKVLESFMYGYEAGAKYANSNIKVVSQYVGTFGDFGLGRSTASNMYRDGV
DIIFAAAGLSGIGVIEAAKELGPDHYIIGVDQDQSYLAPNNVIVSAVKKVDSLMYSLTKKYLETGVLDGG
KTMFLGLKEDGLGLVLNENLKSNYSEIYNKSLKIGQSIMNGIIKVPYDKVSYDNFVLQMEN

Molecule Role : Protective antigen
Molecule Role Annotation : (Bryksin et al., 2005)

4. Borrelia Burgdorferi Outer Surface Lipoprotein Bba64

Gene Name : Borrelia Burgdorferi Outer Surface Lipoprotein Bba64
Sequence Strain (Species/Organism) : Borrelia burgdorferi
NCBI Protein GI : 4ALY_B
Other Database IDs : CDD:283392
Taxonomy ID : 224326
Protein Name : Borrelia Burgdorferi Outer Surface Lipoprotein Bba64
Protein pI : 9.56
Protein Weight : 32115.71
Protein Length : 317
Protein Note : helix 9

Protein Sequence : Show Sequence

>pdb|4ALY|B Chain B, P35 ANTIGEN
GAMGKDSNESKKHKKEKRKGKVENLLVAINNLKNPTKPAAGKNKANSKASKQKNNPNANANNAPKKILDP
EVAKLIQKILDRSENIIQISEMDSSRGEPNDQFGMRAEIFSKIFFNANSTVHFDSHEYTEERRMLYTSLN
FNEGKIFNLGQILSKLSQDSNYRGLVKETLINRGFSIQLAMEEISAKILNVKDKLQQLNKPNLETLYNDF
EKLTSLKEKWLKDTDDLIDEYNTNPDLQTDVSKLNDTLRSKNSRAQFANIHDIILDLVNTTTNILAPIQ

Molecule Role : Protective antigen
Molecule Role Annotation : (Brandt et al., 2014)

5. DbpA

Gene Name : DbpA
Sequence Strain (Species/Organism) : Borrelia burgdorferi 297
VO ID : VO_0012387
NCBI Gene ID : 8319341
NCBI Protein GI : 256041910
Locus Tag : Bbu297_A24
Genbank Accession : U75866
Protein Accession : YP_003110629
Taxonomy ID : 521009
Plasmid No : 297_lp54
Gene Starting Position : 13807
Gene Ending Position : 14370
Gene Strand (Orientation) : -
Protein Name : decorin binding protein A
Protein pI : 9.68
Protein Weight : 19412.03
Protein Length : 187
Protein Note : identified by match to protein family HMM PF02352

DNA Sequence : Show Sequence

>NC_013128.1:13807-14370 Borrelia burgdorferi 297 plasmid 297_lp54, complete sequence
ATTACGATTTAGCAGTGCTGTCTTCGGTATTTTTTTTCTTTAAGGTGTCTTGGTTTTTCTTGTGAACCCT
TTGTAATTTTTCTCTCATTTTTTTTGCAATTTCAAGCACTCCTTGAGCTGTAGTTGGAGGATTCTCTTCA
GCTGCCATTGAGACTGTTTTTGTCATCTCTTGTATTCCCAATTCTTGTAATGGTTTTGAGACTTCAAACA
TTAAATCATACATTGCTGAGAATTCACCACTACTTCCAGTTTCTTTAAGTTTAGTAGCTTCCTCTTCTAT
TGCTATTACGAATTTTTCCGCTACTGTAGTAGCTCGCACTTTTGCTTCAAGTATGAATGGATTTTCTGAT
ACCCCACTACCCGTTTTTTTATCTTTAAAGGCATCAAAATTTACACCCATAGAAGCAGCCTTTTTTTTAA
TTGCATCTATTTCATCTACAATGGCTTTAGCTGATGATTCTAATTTGATTTTTGTTGCTCCTGTTAGTCC
ACATGATATAAGTAGGTTAACAAGTATAGTTAGTTTAAGTAAATTGTTAAAAGTTTTATTATTACATTTA
ATCA

Protein Sequence : Show Sequence

>YP_003110629.1 decorin binding protein A (plasmid) [Borreliella burgdorferi 297]
MIKCNNKTFNNLLKLTILVNLLISCGLTGATKIKLESSAKAIVDEIDAIKKKAASMGVNFDAFKDKKTGS
GVSENPFILEAKVRATTVAEKFVIAIEEEATKLKETGSSGEFSAMYDLMFEVSKPLQELGIQEMTKTVSM
AAEENPPTTAQGVLEIAKKMREKLQRVHKKNQDTLKKKNTEDSTAKS

Molecule Role : Protective antigen
Molecule Role Annotation : Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi (Hanson et al., 2000).
Related Vaccine(s): B. burgdorferi DbpA and OspA Protein Vaccine , B. burgdorferi DbpA Protein Vaccine

6. dbpA

Gene Name : dbpA
Sequence Strain (Species/Organism) : Borrelia burgdorferi
NCBI Protein GI : ABD95792
Other Database IDs : CDD:280507
Taxonomy ID : 521007
Protein Name : DbpA
Protein pI : 9.11
Protein Weight : 21058.51
Protein Length : 254
Protein Note : Decorin binding protein; pfam02352

Protein Sequence : Show Sequence

>ABD95792.1 DbpA, partial [Borreliella burgdorferi N40]
MNKYQKTFKIFNFKNLLKLSLLVALISCGLKGETKIILERSAKDITDEINKIKKDAADNNVNFAAFTDSE
TGSKVSENSFILEAKVRATTVAEKFVTAIEGEATKLKKTGSSGEFSAMYNMMLEVSGPLEELGVLRMTKT
VTDAAEQHPTTTAEGILEIAKIMKTKLQRVHTKNYCALEKKKNPNFTDEKCKNN

Molecule Role : Protective antigen
Molecule Role Annotation : (Ulbrandt et al., 2001)

7. fla

Gene Name : fla
Sequence Strain (Species/Organism) : Borrelia burgdorferi HB19
NCBI Protein GI : 435009
Other Database IDs : CDD:183758
CDD:144315
CDD:144340
GOA:Q44895
HSSP: 1ORY
InterPro: IPR001029
InterPro: IPR001444
InterPro: IPR001492
InterPro: IPR019776
UniProtKB/TrEMBL: Q44895
Taxonomy ID : 139
Gene Strand (Orientation) : ?
Protein Name : flagellin
Protein Length : 336
Protein Note : flagellin; Provisional

Protein Sequence : Show Sequence

>gi|435009|emb|CAA53011.1| flagellin [Borrelia burgdorferi]
MIINHNTSAINASRNNGINAANLSKTQEKLSSGYRINRASDDAAGMGVSGKINAQIRGLSQASRNTSKAI
NFIQTTEGNLNEVEKVLVRMKELAVQSGNGTYSDADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKS
ASQNVRTAEELGMQPAKINTPASLSGSQASWTLRVHVGAPQDEAIAVNIYAANVANLFSGEGAQTAQAAP
VQEGVQQEGAQQPAPATAPSQGGVNSPVNVTTTVDANTSLAKIENAIRMISDQRPNLGAFQNRLESIKDS
TEYAIENLKASYAQIKDATMTDEVVAATTNSILTQSAMAMIAQANQLPQYVLSLLR

Molecule Role : Virmugen
Molecule Role Annotation : A flagella-less mutant of Borrelia burgdorferi (HB19Fla-) was attenuated in immunodeficient SCID mice. Mice were challenged 28 days later with virulent strain Sh. 2 and were protected from challenge (Sadziene et al., 1996).
Related Vaccine(s): Borrelia burgdorferi fla mutant vaccine

8. OspA

Gene Name : OspA
Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
VO ID : VO_0012384
NCBI Gene ID : 1194357
NCBI Protein GI : 11496927
Locus Tag : BB_A15
Genbank Accession : AE000790
Protein Accession : NP_045688
3D structure: PDB ID : 2HKD
Taxonomy ID : 224326
Plasmid No : lp54
Gene Starting Position : 9456
Gene Ending Position : 10277
Gene Strand (Orientation) : +
Protein Name : outer surface protein A
Protein pI : 9.36
Protein Weight : 26986.42
Protein Length : 273
Protein Note : similar to SP:P14013 GB:L23137 GB:L23138 GB:L23139 GB:L23140 percent identity: 98.90; identified by sequence similarity; putative

DNA Sequence : Show Sequence

>NC_001857.2:9456-10277 Borrelia burgdorferi B31 plasmid lp54, complete sequence
TATGAAAAAATATTTATTGGGAATAGGTCTAATATTAGCCTTAATAGCATGTAAGCAAAATGTTAGCAGC
CTTGACGAGAAAAACAGCGTTTCAGTAGATTTGCCTGGTGAAATGAAAGTTCTTGTAAGCAAAGAAAAAA
ACAAAGACGGCAAGTACGATCTAATTGCAACAGTAGACAAGCTTGAGCTTAAAGGAACTTCTGATAAAAA
CAATGGATCTGGAGTACTTGAAGGCGTAAAAGCTGACAAAAGTAAAGTAAAATTAACAATTTCTGACGAT
CTAGGTCAAACCACACTTGAAGTTTTCAAAGAAGATGGCAAAACACTAGTATCAAAAAAAGTAACTTCCA
AAGACAAGTCATCAACAGAAGAAAAATTCAATGAAAAAGGTGAAGTATCTGAAAAAATAATAACAAGAGC
AGACGGAACCAGACTTGAATACACAGGAATTAAAAGCGATGGATCTGGAAAAGCTAAAGAGGTTTTAAAA
GGCTATGTTCTTGAAGGAACTCTAACTGCTGAAAAAACAACATTGGTGGTTAAAGAAGGAACTGTTACTT
TAAGCAAAAATATTTCAAAATCTGGGGAAGTTTCAGTTGAACTTAATGACACTGACAGTAGTGCTGCTAC
TAAAAAAACTGCAGCTTGGAATTCAGGCACTTCAACTTTAACAATTACTGTAAACAGTAAAAAAACTAAA
GACCTTGTGTTTACAAAAGAAAACACAATTACAGTACAACAATACGACTCAAATGGCACCAAATTAGAGG
GGTCAGCAGTTGAAATTACAAAACTTGATGAAATTAAAAACGCTTTAAAATA

Protein Sequence : Show Sequence

>NP_045688.1 outer surface protein A (plasmid) [Borreliella burgdorferi B31]
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKN
NGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRA
DGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAAT
KKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK

Molecule Role : Protective antigen
Molecule Role Annotation : Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
Related Vaccine(s): B. burgdorferi DbpA and OspA Protein Vaccine , B. burgdorferi DNA vaccine encoding strain B31 OspA , B. burgdorferi OspA Protein Vaccine

9. OspB

Gene Name : OspB
Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
VO ID : VO_0012385
NCBI Gene ID : 1194340
NCBI Protein GI : 365823348
Locus Tag : BB_A16
Genbank Accession : AE000790
Protein Accession : NP_045689
Taxonomy ID : 224326
Plasmid No : lp54
Gene Starting Position : 10287
Gene Ending Position : 11177
Gene Strand (Orientation) : +
Protein Name : outer surface protein B
Protein pI : 9.6
Protein Weight : 30144.4
Protein Length : 296
Protein Note : similar to GB:L23136 SP:P17739 GB:L23137 GB:L23138 GB:L23139 percent identity: 98.65; identified by sequence similarity; putative

DNA Sequence : Show Sequence

>NC_001857.2:10287-11177 Borrelia burgdorferi B31 plasmid lp54, complete sequence
TATGAGATTATTAATAGGATTTGCTTTAGCGTTAGCTTTAATAGGATGTGCACAAAAAGGTGCTGAGTCA
ATTGGTTCTCAAAAAGAAAATGATCTAAACCTTGAAGACTCTAGTAAAAAATCACATCAAAACGCTAAAC
AAGACCTTCCTGCGGTGACAGAAGACTCAGTGTCTTTGTTTAATGGTAATAAAATTTTTGTAAGCAAAGA
AAAAAATAGCTCCGGCAAATATGATTTAAGAGCAACAATTGATCAGGTTGAACTTAAAGGAACTTCCGAT
AAAAACAATGGTTCTGGAACCCTTGAAGGTTCAAAGCCTGACAAGAGTAAAGTAAAATTAACAGTTTCTG
CTGATTTAAACACAGTAACCTTAGAAGCATTTGATGCCAGCAACCAAAAAATTTCAAGTAAAGTTACTAA
AAAACAGGGGTCAATAACAGAGGAAACTCTCAAAGCTAATAAATTAGACTCAAAGAAATTAACAAGATCA
AACGGAACTACACTTGAATACTCACAAATAACAGATGCTGACAATGCTACAAAAGCAGTAGAAACTCTAA
AAAATAGCATTAAGCTTGAAGGAAGTCTTGTAGGCGGAAAAACAACAGTGGAAATTAAAGAAGGTACTGT
TACTCTAAAAAGAGAAATTGAAAAAGATGGAAAAGTAAAAGTCTTTTTGAATGACACTGCAGGTTCTAAC
AAAAAAACAGGTAAATGGGAAGACAGTACTAGCACTTTAACAATTAGTGCTGACAGCAAAAAAACTAAAG
ATTTGGTGTTCTTAACAGATGGTACAATTACAGTACAACAATACAACACAGCTGGAACCAGCCTAGAAGG
ATCAGCAAGTGAAATTAAAAATCTTTCAGAGCTTAAAAACGCTTTAAAATA

Protein Sequence : Show Sequence

>NP_045689.2 outer surface protein B (plasmid) [Borreliella burgdorferi B31]
MRLLIGFALALALIGCAQKGAESIGSQKENDLNLEDSSKKSHQNAKQDLPAVTEDSVSLFNGNKIFVSKE
KNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNTVTLEAFDASNQKISSKVTK
KQGSITEETLKANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGGKTTVEIKEGTV
TLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEG
SASEIKNLSELKNALK

Molecule Role : Protective antigen
Molecule Role Annotation : Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
Related Vaccine(s): B. burgdorferi OspB Protein Vaccine

10. OspC

Gene Name : OspC
Sequence Strain (Species/Organism) : Borrelia burgdorferi B31
VO ID : VO_0012386
NCBI Gene ID : 1194415
NCBI Protein GI : 11497024
Locus Tag : BB_B19
Genbank Accession : AE000792
Protein Accession : NP_047005
3D structure: PDB ID : 1GGQ
Taxonomy ID : 224326
Plasmid No : cp26
Gene Starting Position : 16902
Gene Ending Position : 17534
Gene Strand (Orientation) : +
Protein Name : outer surface protein C
Protein pI : 8.68
Protein Weight : 21347.6
Protein Length : 210
Protein Note : similar to GB:AE000792 percent identity: 100.00; identified by sequence similarity; putative

DNA Sequence : Show Sequence

>NC_001903.1:16902-17534 Borrelia burgdorferi B31 plasmid cp26, complete sequence
AATGAAAAAGAATACATTAAGTGCAATATTAATGACTTTATTTTTATTTATATCTTGTAATAATTCAGGG
AAAGATGGGAATACATCTGCAAATTCTGCTGATGAGTCTGTTAAAGGGCCTAATCTTACAGAAATAAGTA
AAAAAATTACGGATTCTAATGCGGTTTTACTTGCTGTGAAAGAGGTTGAAGCGTTGCTGTCATCTATAGA
TGAAATTGCTGCTAAAGCTATTGGTAAAAAAATACACCAAAATAATGGTTTGGATACCGAAAATAATCAC
AATGGATCATTGTTAGCGGGAGCTTATGCAATATCAACCCTAATAAAACAAAAATTAGATGGATTGAAAA
ATGAAGGATTAAAGGAAAAAATTGATGCGGCTAAGAAATGTTCTGAAACATTTACTAATAAATTAAAAGA
AAAACACACAGATCTTGGTAAAGAAGGTGTTACTGATGCTGATGCAAAAGAAGCCATTTTAAAAACAAAT
GGTACTAAAACTAAAGGTGCTGAAGAACTTGGAAAATTATTTGAATCAGTAGAGGTCTTGTCAAAAGCAG
CTAAAGAGATGCTTGCTAATTCAGTTAAAGAGCTTACAAGCCCTGTTGTGGCAGAAAGTCCAAAAAAACC
TTA

Protein Sequence : Show Sequence

>NP_047005.1 outer surface protein C (plasmid) [Borreliella burgdorferi B31]
MKKNTLSAILMTLFLFISCNNSGKDGNTSANSADESVKGPNLTEISKKITDSNAVLLAVKEVEALLSSID
EIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGLKEKIDAAKKCSETFTNKLKE
KHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVVAESPKKP

Molecule Role : Protective antigen
Molecule Role Annotation : Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
Related Vaccine(s): B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato , B. burgdorferi OspC Protein Vaccine

11. revA

Gene Name : revA
Sequence Strain (Species/Organism) : Borrelia burgdorferi
NCBI Protein GI : NP_051318
Other Database IDs : CDD:309195
Taxonomy ID : 224326
Protein Name : rev protein
Protein pI : 8.99
Protein Weight : 17238.45
Protein Length : 229
Protein Note : Borrelia burgdorferi REV protein; pfam03978

Protein Sequence : Show Sequence

>NP_051318.1 rev protein (plasmid) [Borreliella burgdorferi B31]
MRNKNIFKLFFASMLFVMACKAYVEEKKEIDSLMEDVLALVNDSSGGKFKDYKDKINELKENLKDIGNAE
LKEKLLNLQNSFQDKLAAKLAALKAAKNTIENITDKDQDISKRKIWSEAKLVGVTVPLLGSNTSGNGDKM
SKNAVEQIDKVIKFLEEGTN

Molecule Role : Protective antigen
Molecule Role Annotation : (Floden et al., 2013)

12. vraA

Gene Name : vraA
Sequence Strain (Species/Organism) : Borrelia burgdorferi
NCBI Protein GI : AAC66203
Other Database IDs : CDD:283392
Taxonomy ID : 224326
Protein Name : virulent strain-associated repetitive antigen A (VraA protein)
Protein pI : 8.45
Protein Weight : 53912.27
Protein Length : 574
Protein Note : Borrelia burgdorferi virulent strain associated lipoprotein; pfam05714

Protein Sequence : Show Sequence

>AAC66203.1 virulent strain-associated repetitive antigen A (VraA protein) (plasmid) [Borreliella burgdorferi B31]
MKYHIITTIFVFLFLACRPDFNIDQKDIKYPPTEKSRPKTESSKQKESKPKTEEELKKKQQEEELKKKQQ
EEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKK
QQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELKKKQQEEELK
KKQQEEELKKKQQEEELKKKQQEEELKKKQQEEEKEELRKQQLKNTLSNDLKKQIESAYNFKEKYVKSME
KEPEDHYGMTSFRGLNWGPGTEDISDNTERSIRYRRHTYTVLSPLDPHELKEFANIIQDINKLASVASIF
NSFSAIGGALDIVSDHLYFKKDNLDKLDIADLEILKNSFEQILYIKGSVAGKAKKLLLDYKNLKTDINKL
KSYSNELVNGIKQQALEAENLEELIVSKYKL

Molecule Role : Protective antigen
Molecule Role Annotation : (Labandeira-Rey et al., 2001)

III. Vaccine Information

1. B. burgdorferi DbpA and OspA Protein Vaccine

a. Vaccine Ontology ID:

VO_0004188

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

DbpAN40-OspAN40

e. Gene Engineering of DbpA

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Gene Engineering of OspA

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

g. Adjuvant:

VO ID: VO_0000139

h. Adjuvant:

VO ID: VO_0000142

i. Immunization Route

Intraperitoneal injection (i.p.)

j. Mouse Response

Host Strain: C3H/HeJ
Vaccination Protocol: Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000).
Challenge Protocol: At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000).
Efficacy: All mice immunized with the combined DbpAN40-OspAN40 vaccine (5 μg of each antigen) were protected against even the highest challenge dose of 10^6 spirochetes (Hanson et al., 2000).

2. B. burgdorferi DbpA Protein Vaccine

a. Vaccine Ontology ID:

VO_0004027

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

The recombinant fusion lipoprotein pp2:DbpAN40(His)6 (DbpAN40) (Hanson et al., 2000).

e. Gene Engineering of DbpA

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000139

g. Adjuvant:

VO ID: VO_0000142

h. Immunization Route

Intraperitoneal injection (i.p.)

i. Mouse Response

Host Strain: C3H/HeJ
Vaccination Protocol: Mice were immunized by intraperitoneal injection of 10 μg of DbpAN40, 10 μg of OspAN40, 5 μg of DbpAN40 plus 5 μg of OspAN40, or 2.5 μg of E. coli protein extract with complete Freund's adjuvant and then, 4 weeks later, were given a second immunization of protein in incomplete Freund's adjuvant (Hanson et al., 2000).
Challenge Protocol: At week 6, five of the mice in each immunization group were challenged by subcutaneous injection, into the dorsolateral thorax, of cloned B. burgdorferi N40 (Hanson et al., 2000).
Efficacy: Mice immunized with recombinant DbpA protein are protected against challenge with Borrelia burgdorferi. Nearly all mice immunized with 10 μg of DbpAN40 were protected from challenge with 10^3 or 10^4 spirochetes (Hanson et al., 2000).

3. B. burgdorferi DNA vaccine encoding strain B31 OspA

a. Vaccine Ontology ID:

VO_0004513

b. Type:

DNA vaccine

c. Status:

Research

d. Gene Engineering of OspA

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

e. Vector:

VR2210 (Luke et al., 1997)

f. Immunization Route

Intramuscular injection (i.m.)

g. Mouse Response

Vaccination Protocol: Female C3H/HeN mice (6-10 weeks old) were injected with plasmid diluted in sterile 0.9% saline. Each mouse received intramuscular injections into left and right rectus femoris muscles with 50 J-lg of plasmid in 50 J-lL of saline. For immunization with protein, mice were injected in the back with purified B31 rOspA lipoprotein (Luke et al., 1997).
Vaccine Immune Response Type: VO_0000286
Immune Response: Sera from mice immunized with the ospA-bearing plasmid DNA had high levels of antibody that recognized both native and rOspA lipoprotein (Luke et al., 1997).
Challenge Protocol: Mice were challenged intradermally by injecting 100 x ID50 of the infectious isolate at the base of the tail (Luke et al., 1997).
Efficacy: Immunization with VR2210 protected 100% of mice against infection with Sh-2-82 or N40, 2 infectious strains of B. burgdorferi (Luke et al., 1997).

4. B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato

a. Vaccine Ontology ID:

VO_0004413

b. Type:

DNA vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Mouse

e. Gene Engineering of OspC

Type: DNA vaccine construction
Description:
Detailed Gene Information: Click here.

f. Vector:

pCMV-TPA/ZS7 (Scheiblhofer et al., 2003)

g. Immunization Route

Intradermal injection (i.d.)

h. Mouse Response

Vaccine Immune Response Type: VO_0000286
Immune Response: Both i.d. injection and gene-gun application of plasmid DNA encoding the ospC gene induced a reliable humoral response with high antibody titers, antigen-specific cellular responses and, most importantly, provided effective protection (Scheiblhofer et al., 2003).
Challenge Protocol: Control groups received challenge doses B. burgdorferi strain ZS7 of 10^4, 10^3, 10^2, and 10 live spirochetes per animal (Scheiblhofer et al., 2003).
Efficacy: The protection rate after challenge with 10 B. burgdorferi organisms per mouse was between 80% and 100% for all groups. These results demonstrate that a DNA vaccine encoding OspC of B. burgdorferi is suitable for inducing protection against Lyme borreliosis (Scheiblhofer et al., 2003).

5. B. burgdorferi OspA Protein Vaccine

a. Vaccine Ontology ID:

VO_0004028

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

Recombinant OspA protein

e. Gene Engineering of OspA

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000139

g. Adjuvant:

VO ID: VO_0000142

h. Immunization Route

Intraperitoneal injection (i.p.)

i. Mouse Response

Host Strain: C3H/HeN
Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 10^7 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
Efficacy: Mice immunized with recombinant OspA protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).

6. B. burgdorferi OspB Protein Vaccine

a. Vaccine Ontology ID:

VO_0004029

b. Type:

Recombinant vector vaccine

c. Status:

Research

d. Antigen

Recombinant OspB protein

e. Gene Engineering of OspB

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000139

g. Adjuvant:

VO ID: VO_0000142

h. Immunization Route

Intraperitoneal injection (i.p.)

i. Mouse Response

Host Strain: C3H/HeN
Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
Efficacy: Mice immunized with recombinant OspB protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).

7. B. burgdorferi OspC Protein Vaccine

a. Vaccine Ontology ID:

VO_0004030

b. Type:

Subunit vaccine

c. Status:

Research

d. Antigen

Recombinant OspC protein

e. Gene Engineering of OspC

Type: Recombinant protein preparation
Description:
Detailed Gene Information: Click here.

f. Adjuvant:

VO ID: VO_0000139

g. Adjuvant:

VO ID: VO_0000142

h. Immunization Route

Intraperitoneal injection (i.p.)

i. Mouse Response

Host Strain: C3H/HeN
Vaccination Protocol: Four-week-old female mice were primed intraperitoneally with 20 μg of each immunogen in 200 μL of complete Freund's adjuvant. Three boosts containing the same amount of immunogen in incomplete Freund's adjuvant were administered at 2, 5, and 8 weeks following the initial injection (Probert and LeFebvre, 1994).
Challenge Protocol: Ten days following the final boost, mice received a subcutaneous inoculation containing 107 SON 188 organisms in 100 μl of BSK II medium (Probert and LeFebvre, 1994).
Efficacy: Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Hanson et al., 1998).

8. Borrelia burgdorferi fla mutant vaccine

a. Vaccine Ontology ID:

VO_0002809

b. Type:

Live, attenuated vaccine

c. Status:

Research

d. Host Species as Laboratory Animal Model:

Mouse

e. Gene Engineering of fla

Type: Gene mutation
Description: This fla mutant is from Borrelia burgdorferi (Sadziene et al., 1996).
Detailed Gene Information: Click here.

f. Immunization Route

Intradermal injection (i.d.)

g. Mouse Response

Persistence: A fla mutant is attenuated in SCID mice (Sadziene et al., 1996).
Efficacy: A fla mutant induces protection in mice from challenge with wild type B. burgdorferi 28 days after inoculation (Sadziene et al., 1996).

9. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20)

a. Manufacturer:

Wyeth, Boehringer Ingelheim Vetmedica, Inc.

b. Vaccine Ontology ID:

VO_0002239

c. Type:

Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

10. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)

a. Manufacturer:

Wyeth

b. Vaccine Ontology ID:

VO_0002244

c. Type:

Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

11. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)

a. Manufacturer:

Wyeth

b. Vaccine Ontology ID:

VO_0002243

c. Type:

Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

12. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)

a. Manufacturer:

Wyeth

b. Vaccine Ontology ID:

VO_0002241

c. Type:

Live, attenuated vaccine; Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

13. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)

a. Manufacturer:

Wyeth

b. Vaccine Ontology ID:

VO_0002242

c. Type:

Live, attenuated vaccine; Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

14. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)

a. Manufacturer:

Wyeth

b. Vaccine Ontology ID:

VO_0002219

c. Type:

Live, attenuated vaccine; Inactivated or "killed" vaccine

d. Status:

Licensed

e. Location Licensed:

USA

f. Host Species for Licensed Use:

Gray wolf

IV. References

1. Brandt et al., 2014: Brandt KS, Patton TG, Allard AS, Caimano MJ, Radolf JD, Gilmore RD. Evaluation of the Borrelia burgdorferi BBA64 protein as a protective immunogen in mice. Clinical and vaccine immunology : CVI. 2014; 21(4); 526-533. [PubMed: 24501342].

2. Bryksin et al., 2005: Bryksin AV, Godfrey HP, Carbonaro CA, Wormser GP, Aguero-Rosenfeld ME, Cabello FC. Borrelia burgdorferi BmpA, BmpB, and BmpD proteins are expressed in human infection and contribute to P39 immunoblot reactivity in patients with Lyme disease. Clinical and diagnostic laboratory immunology. 2005; 12(8); 935-940. [PubMed: 16085911].

3. Floden et al., 2013: Floden AM, Gonzalez T, Gaultney RA, Brissette CA. Evaluation of RevA, a fibronectin-binding protein of Borrelia burgdorferi, as a potential vaccine candidate for lyme disease. Clinical and vaccine immunology : CVI. 2013; 20(6); 892-899. [PubMed: 23595502].

4. Hanson et al., 1998: Hanson MS, Cassatt DR, Guo BP, Patel NK, McCarthy MP, Dorward DW, Höök M. Active and passive immunity against Borrelia burgdorferi decorin binding protein A (DbpA) protects against infection. Infection and immunity. 1998; 66(5); 2143-2153. [PubMed: 9573101].

5. Hanson et al., 2000: Hanson MS, Patel NK, Cassatt DR, Ulbrandt ND. Evidence for vaccine synergy between Borrelia burgdorferi decorin binding protein A and outer surface protein A in the mouse model of lyme borreliosis. Infection and immunity. 2000; 68(11); 6457-6460. [PubMed: 11035759].

6. Labandeira-Rey et al., 2001: Labandeira-Rey M, Baker EA, Skare JT. VraA (BBI16) protein of Borrelia burgdorferi is a surface-exposed antigen with a repetitive motif that confers partial protection against experimental Lyme borreliosis. Infection and immunity. 2001; 69(3); 1409-1419. [PubMed: 11179306].

7. Probert and LeFebvre, 1994: Probert WS, LeFebvre RB. Protection of C3H/HeN mice from challenge with Borrelia burgdorferi through active immunization with OspA, OspB, or OspC, but not with OspD or the 83-kilodalton antigen. Infection and immunity. 1994; 62(5); 1920-1926. [PubMed: 8168958].

8. Sadziene et al., 1996: Sadziene A, Thompson PA, Barbour AG. A flagella-less mutant of Borrelia burgdorferi as a live attenuated vaccine in the murine model of Lyme disease. The Journal of infectious diseases. 1996; 173(5); 1184-1193. [PubMed: 8627071].

9. Salyers and Whitt., 2002: Abigail A. Salyers, Dixie D. Whitt. The Spirochetes: Borrelia burgdorferi and Treponema pallidum. 187-199. Bacterial Pathogenesis: A Molecular Approach. 2002. ASM Press, Washington D.C. USA.

10. Ulbrandt et al., 2001: Ulbrandt ND, Cassatt DR, Patel NK, Roberts WC, Bachy CM, Fazenbaker CA, Hanson MS. Conformational nature of the Borrelia burgdorferi decorin binding protein A epitopes that elicit protective antibodies. Infection and immunity. 2001; 69(8); 4799-4807. [PubMed: 11447153].

11. Wiki: B. burgdorferi: Wiki: Borrelia burgdorferi [http://en.wikipedia.org/wiki/Borrelia_burgdorferi]