Western equine encephalomyelitis virus |
Table of Contents |
- General Information
- NCBI Taxonomy ID
- Disease
- Introduction
- Vaccine Related Pathogen Genes
- 26S
(Protective antigen)
- 6K
(Protective antigen)
- E1
(Protective antigen, Virmugen)
- E1 protein
(Protective antigen)
- E2
(Protective antigen, Virmugen)
- E3 protein
(Protective antigen)
- PE2
(Virmugen)
- Vaccine Information
- Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.23)
- Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.27)
- Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.20)
- Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.21)
- Encephalomyelitis Eastern & Western, Killed Virus Vaccine (USDA: 1475.00)
- Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.00)
- Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.01)
- Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.21)
- Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.26)
- Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.23)
- Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.24)
- Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A0)
- Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A1)
- Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.20)
- Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.23)
- Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.24)
- Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.45)
- Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.46)
- Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 13W5.20)
- Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 46W5.21)
- Encephalomyelitis-Rhinopneumonitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4844.30)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.22)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.23)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.24)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.32)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.23)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.24)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.32)
- Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.33)
- Encephalomyelitis-Rhinopneumonitis-Influenza-West Nile Virus Eastern & Western, Killed Virus, Killed Flavivirus Chimera Vaccine-Tetanus Toxoid (USDA: 4855.R2)
- Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine (USDA: 14W5.23)
- Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.20)
- Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.23)
- Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 14W5.22)
- Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.21)
- Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.22)
- Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine (USDA: 14W7.R0)
- Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine-Tetanus Toxoid (USDA: 48W9.R0)
- WEE virus DNA vaccine pVHX-6 encoding 26S
- WEEV DNA Vaccine encoding 6K-E1 Protein
- WEEV Subunit E2 Protein Vaccine
- Western equine encephalomyelitis virus PE2/E1 mutant vaccine
- Western equine encephalomyelitis virus PE2/E2 mutant virus
- References
|
I. General Information |
1. NCBI Taxonomy ID: |
11039 |
2. Disease: |
Western equine encephalomyelitis (WEE) |
3. Introduction |
The Western equine encephalomyelitis virus is the causative agent of relatively uncommon viral disease Western equine encephalomyelitis (WEE). An Alphavirus of the family Togaviridae, the WEE virus is an arbovirus (arthropod-borne virus) transmitted by mosquitoes of the genera Culex and Culiseta. There have been under 700 confirmed cases in the U.S. since 1964.
In the U.S. WEE is seen primarily in states west of the Mississippi River. The disease is also seen in countries of South America. WEE is commonly a subclinical infection; symptomatic infections are uncommon. However, the disease can cause serious sequelae in infants and children. Unlike Eastern equine encephalitis, the overall mortality of WEE is low (approximately 4%) and is associated mostly with infection in the elderly. There is no vaccine for WEE and there are no licensed therapeutic drugs in the U.S. for this infection.
Western equine encephalitis virus was one of more than a dozen agents that the United States researched as potential biological weapons before the nation suspended its biological weapons program (Wiki: Western equine encephalomyelitis virus). |
II. Vaccine Related Pathogen Genes |
1. 26S |
-
Gene Name :
26S
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
NCBI Protein GI :
7330241
-
Other Database IDs :
CDD:279312
CDD:279849 CDD:279311 CDD:279870
-
Taxonomy ID :
11039
-
Gene Strand (Orientation) :
?
-
Protein Name :
structural polyprotein
-
Protein pI :
8.62
-
Protein Weight :
127600.08
-
Protein Length :
1325
-
Protein Note :
Alphavirus core protein; pfam00944
-
Protein Sequence : Show Sequence
>AAF60166.1 structural polyprotein [Western equine encephalitis virus]
MFPYPQLNFPPVYPTNPMAYRDPNPPRCRWRPFRPPLAAQIEDLRRSIANLTFKQRAPNPPPCPPPKKKK
SAPEPKPTQPKKKKQQAKKTKRKPKPWKRQRMCMKLESDKTFPIMLNGQVNGYACVVGGRLMKPLHVEGK
IDNEQLAAVKLKKASMYDLEYGDVPQNMKSDTLQYTSDKPPGFYNWHHGAVQYENGRFTVPRGVGGKGDS
GRPILDNRGRVVAIVLGGANEGTRTALSVVTWNQKGVTIKDTPEGSEPWSLVTALCVLSNVTFPCDKPPV
CYSLAPERTLDVLEENVDNPNYDTLLENVLKCPSRRPKRSITDDFTLTSPYLGFCPNCRHSAPCFSPIKI
ENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSYDHDHDIEEDSMEKIAISTSGPCRRLGHKGYFL
LAQCPPGDSVTVSITSGASENSCTVEFKIRRKFVGREEYLFPPVHGKRVKCHVYDHLKERSAGYITMHRP
SPHAYKSYLKEASGEVYIKPPSGKNVTYECKCGDYSTGIVSTPTKMNGCTKAKQCIAYKSDQTKWVFNSP
DLIRHTDHSVQGKLHIPFRLIPTVCPVPLAHTPTVTKWFKGITLHLTATRPTLLTTRKLGLRADATAEWI
TGTTSRNFSVGREGLEYVWGNHEPVRVWAQESAPSDPHGWPHEIIIHYYHRHPVYTVIVLCGVALAILVG
TASSAACITKARRDCLTPYALAPNATVPTALAVLCCIRPTNAETFGETLNHLWFNNQPFLWAQLCIPLAA
LIILFRCFSCCMPFLLVAGVCLGKVDAFEHATTVPNVPGIPYKALVERAGYAPLNLEIKVVSSELTPSTN
KEYVTCKFHTVIPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPD
CTIDHAVALRVHTAALKVGLRIVYGNTTAYLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGL
VYNYDFPEYGAMKPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQE
TAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTADCIYSADFGGSLTLQYKADR
EGHCPVHSHSTTAVLKEATTHVTATGSITLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHKV
DQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTRR
-
Molecule Role :
Protective antigen
- Related Vaccine(s):
WEE virus DNA vaccine pVHX-6 encoding 26S
|
2. 6K |
-
Gene Name :
6K
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
VO ID :
VO_0011307
-
NCBI Protein GI :
29611993
-
Other Database IDs :
CDD:279870
-
Taxonomy ID :
11039
-
Gene Strand (Orientation) :
?
-
Protein Name :
6K protein
-
Protein pI :
7.08
-
Protein Weight :
6303.88
-
Protein Length :
117
-
Protein Note :
Alphavirus E1 glycoprotein; pfam01589
-
Protein Sequence : Show Sequence
>NP_818941.1 6K protein [Western equine encephalitis virus]
ETFGETLNHLWFNNQPFLWAQLCIPLAALVILFRCFSCCMPFLLVAGVCLGKVDA
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).
Note: The 6K protein is part of the 6K-E1 structural protein
- Related Vaccine(s):
WEEV DNA Vaccine encoding 6K-E1 Protein
|
3. E1 |
-
Gene Name :
E1
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
VO ID :
VO_0011306
-
NCBI Nucleotide GI :
17148716
-
NCBI Protein GI :
17148717
-
Protein Accession :
AAL35792.1
-
Other Database IDs :
CDD:279870
-
Taxonomy ID :
11039
-
Gene Strand (Orientation) :
?
-
Protein Name :
glycoprotein
-
Protein pI :
6.22
-
Protein Weight :
33702.07
-
Protein Length :
411
-
Protein Note :
Alphavirus E1 glycoprotein; pfam01589
-
DNA Sequence : Show Sequence
>gi|17148716|gb|AF398393.1| Western equine encephalomyelitis virus glycoprotein (E1) mRNA, partial cds
AGACGCACAGTGCTTTTGTGACAGCGAGAACACGCAACTAAGCGAAGCATATGTCGAGTTTGCTCCAGAT
TGCACTGTAGATCACGCAGTCGCTTTAAAAGTTCACACAGCTGCTTTGAAAGTCAGCCTGCGCATAGTAT
ATGGCAATACCACCGCGCGCCTGGATACGTTCGTTAATGGCGTCACACCAGGTTCCACGCGAGACCTGAA
GGTCATCGCAGGGCCGATATCAGCCGCTTTTTCGCCCTTTGACCATAAAGTCGTTATTAGAAAAGGGCTT
GTCTACAACTATGACTTTCCAGAGTACGGAGCCATGAGACCAGGTGTGTTCGGCGATATTCAAGCATCTT
CGCTAGACGCCAAGGACATAGTAGCCCGCACTGACATACGGCTGCTGAAGCCTTCTGTCAAGAACATCCA
TGTTCCTTACACCCAAGCAGTGTCAGGGTATGAAATGTGGAAGAACAATTCAGGACGGCCACTGCAAGAA
ACGGCACCGTTTGGCTGTAAAATCGAAGTGGAGCCTTTGCGAGCGTCTGATTGCGCTTATGGGCACATCC
CTATCTCAATCGATATTCCTGACGCAGCTTTCGTGAGATCATCAGAGTCACCTACAATTCTAGAAGTCAG
CTGCTCGGTAGCAGACTGCATCTATTCGGCAGACTTTGGAGGCTCACTGACACTACAGTACAAAGCTGAC
AGGGAGGGACACTGTCCAGTTCACTCTCACTCCACTACAGCTGTCTTGAAGGAAGCGACCACACACGTGA
CTGCCATAGGCAGCATAACGCTACATTTCAGTACATCAAGCCCACAAGCAAATTTTATAATTTCGCTGTG
TGGCAAGAAGACTACTTGCAATGCTGAATGCAAACCACCAGAGGACCACATAATTGGTGAACCACACAAG
GTTGACCAGGAATTCCAGGCGGCAGTTTCTAAAACATCCTGGAACTGGCTCGTCGCGCTGTTTGGGGGAG
CATCATCCCTCATTGTTGTAGGACT
-
Protein Sequence : Show Sequence
>AAL35792.1 glycoprotein, partial [Western equine encephalitis virus]
DAQCFCDSENTQLSEAYVEFAPDCTVDHAVALKVHTAALKVSLRIVYGNTTARLDTFVNGVTPGSTRDLK
VIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMRPGVFGDIQASSLDAKDIVARTDIRLLKPSVKNIH
VPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASDCAYGHIPISIDIPDAAFVRSSESPTILEVS
CSVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAIGSITLHFSTSSPQANFIISLC
GKKTTCNAECKPPEDHIIGEPHKVDQEFQAAVSKTSWNWLVALFGGASSLIVVGL
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).
Note: The E1 glycoprotein is part of the 6K-E1 structural protein
-
Additional Molecule Role :
Virmugen
-
Additional Molecule Role Annotation :
A PE2 mutant combined with a deletion in E1 (WE2130) induced low-level viremia in chickens and protected against challenge with wild type WEE after 2 weeks. This study also found that it is unlikely that mosquito transmission of this strain would occur (Turell et al., 2003).
- Related Vaccine(s):
WEEV DNA Vaccine encoding 6K-E1 Protein
,
Western equine encephalomyelitis virus PE2/E1 mutant vaccine
|
4. E1 protein |
-
Gene Name :
E1 protein
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
NCBI Protein GI :
NP_818942
-
Other Database IDs :
CDD:279870
-
Taxonomy ID :
11039
-
Protein Name :
E1 protein
-
Protein pI :
6.77
-
Protein Weight :
43833.76
-
Protein Length :
507
-
Protein Note :
Alphavirus E1 glycoprotein; pfam01589
-
Protein Sequence : Show Sequence
>NP_818942.1 E1 protein [Western equine encephalitis virus]
FEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTNKEYVTCKFHTVIPSPQVKCCGSLECKA
SSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTIDHAVALKVHTAALKVGLRIVYGNT
TAHLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMKPGAFGDIQASSLDA
TDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISI
DIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAVG
SITLHFSTSSPQANFIVSLCGKKSTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSL
IVVGLIVLVCSSMLINTRR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Phillips et al., 2014)
|
5. E2 |
-
Gene Name :
E2
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
VO ID :
VO_0011305
-
NCBI Protein GI :
29611992
-
Other Database IDs :
CDD:279311
-
Taxonomy ID :
11039
-
Gene Strand (Orientation) :
?
-
Protein Name :
E2 protein
-
Protein pI :
8.39
-
Protein Weight :
44557.05
-
Protein Length :
491
-
Protein Note :
Alphavirus E2 glycoprotein; pfam00943
-
Protein Sequence : Show Sequence
>NP_818940.1 E2 protein [Western equine encephalitis virus]
SITDDFTLTSPYLGFCPYCRHSTPCFSPIKIENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSFD
HDHDIKEDSMEKIAISTSGPCRRLGHKGYFLLAQCPPGDSVTVSITSGASENSCTVEKKIRRKFVGREEY
LFPPVHGKLVKCHVYDHLKETSAGYITMHRPGPHAYKSYLEEASGEVYIKPPSGKNVTYECKCGDYSTGI
VSTRTKMNGCTKAKQCIAYKSDQTKWVFNSPDLIRHTDHSVQGKLHIPFRLTPTVCPVPLAHTPTVTKWF
KGITLHLTAMRPTLLTTRKLGLRADATAEWITGSTSRNFSVGREGLEYVWGNHEPVRVWAQESAPGDPHG
WPHEIIIHYYHRHPVYTVIVLCGVALAILVGTASSAACIAKARRDCLTPYALAPNATVPTALAVLCCIRP
TNA
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
This report describes the successful cloning of the E2 gene of WEEV and expression in Escherichia coli as inclusion bodies. The immunogenicity of the refolded rE2 protein was demonstrated by strong humoral and cell mediated immune (CMI) responses in rE2-immunized BALB/c mice. The current study also demonstrated that rE2-immunized mice could be partially protected from lethal challenge of WEEV (Das et al., 2007).
-
Additional Molecule Role :
Virmugen
-
Additional Molecule Role Annotation :
A PE2 mutant combined with a deletion in E2 (WE2102) induced low-level viremia in chickens and protected against challenge with wild type WEE after 2 weeks. This study also found that it is unlikely that mosquito transmission of this strain would occur (Turell et al., 2003).
- Related Vaccine(s):
WEEV Subunit E2 Protein Vaccine
,
Western equine encephalomyelitis virus PE2/E2 mutant virus
|
6. E3 protein |
-
Gene Name :
E3 protein
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
NCBI Protein GI :
NP_818939
-
Other Database IDs :
CDD:279849
-
Taxonomy ID :
11039
-
Protein Name :
E3 protein
-
Protein pI :
4.59
-
Protein Weight :
6609.79
-
Protein Length :
122
-
Protein Note :
In some other alphaviruses, E3 was not detected as a separate protein
-
Protein Sequence : Show Sequence
>NP_818939.1 E3 protein [Western equine encephalitis virus]
SLVTALCVLSNVTFPCDKPPVCYSLTPERTLDVLEENVDNPNYDTLLENVLKCPSRRPKR
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Wu et al., 2007)
|
7. PE2 |
-
Gene Name :
PE2
-
Sequence Strain (Species/Organism) :
Western equine encephalomyelitis virus
-
NCBI Protein GI :
90811336
-
Other Database IDs :
CDD:109979
CDD:190039 CDD:109978 CDD:144979
-
Taxonomy ID :
11039
-
Gene Strand (Orientation) :
?
-
Protein Name :
structural polyprotein
-
Protein Length :
1236
-
Protein Note :
Alphavirus core protein; pfam00944
-
Protein Sequence : Show Sequence
>gi|90811336|gb|ABD98014.1| structural polyprotein [Western equine encephalomyelitis virus]
MFPYPQLNFPPVYPTNPMAYRDPNPPRRRWRPFRPPLAAQIEDLRRSIANLTFKQRAPNPPPGPPPKKKK
SAPKPKPTQPKKKKQQAKKTKRKPKPGKRQRMCMKLESDKTFPIMLNGQVNGYACVVGGRLMKPLHVEGK
IDNEQLAAVKLKKASMYDLEYGDVPQNMKSDTLQYTSDKPPGFYNWHHGAVQYENGRFTVPRGVGGKGDS
GRPILDNRGRVVAIVLGGANEGTRTALSVVTWNQKGVTIKDTPEGSEPWSLVTALCVLSNVTFPCDKPPV
CYSLAPERTLDVLEENVDNPNYDTLLENVLKCPSRRPKRSITDDFTLTSPYLGFCPYCRHSAPCFSPIKI
ENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSYDHDHDIKEDSMEKLAISTSGPCRRLGHKGYFL
LAQCPPGDSVTVSITSGASENSCTVEKKIRRKFVGREEYLFPPVHGKLVKCHVYDHLKETSAGYITMHRP
GPHAYKSYLEEASGEVYIKPPSGKNVTYECKCGDYSTGIVSTRTKMNGCTKAKQCIAYKRDQTKWVFNSP
DLIRHTDHSVQGKLHIPFRLTPTVCPVPLAHTPTVTKWFKGITLHLTATRPTLLTTRKLGLRADATAEWI
TGTTSRNFSVGREGLEYVWGNHEPVRVWAQESAPGDPHGWPHEIIIHYYHRHPVYTVIVLCGVALAILVG
TASSAACIAKARRDCLTPYALAPNATVPTALAVLCCIRPTNAETFGETLNHLWFNNQPFLWAQLCIPLAA
LIILFRCFSCCMPFLLVAGVCLGKVDAFEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTN
KEYVTCKFHTVVPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPD
CTIDHAVALKVHTAALKVGLRIVYGNTTARLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGL
VYNYDFPEYGAMNPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQE
TAPFGCKIEVEPLRATNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKAN
REGHCPVHSHSTTAVLKEATTHVTATGSITLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHK
VDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTRR
-
Molecule Role :
Virmugen
-
Molecule Role Annotation :
A PE2 mutant combined with either a deletion in E2 (WE2102) or E1 (WE2130) induced low-level viremia in chickens and protected against challenge with wild type WEE after 2 weeks. This study also found that it is unlikely that mosquito transmission of these two strains would occur (Turell et al., 2003).
- Related Vaccine(s):
Western equine encephalomyelitis virus PE2/E1 mutant vaccine
,
Western equine encephalomyelitis virus PE2/E2 mutant virus
|
III. Vaccine Information |
|
|
|
|
|
|
1. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.23) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc., Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002266 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
2. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.27) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002268 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
3. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002269 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
4. Encephalomyelitis Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4867.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002270 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
5. Encephalomyelitis Eastern & Western, Killed Virus Vaccine (USDA: 1475.00) |
a. Manufacturer: |
Intervet Inc., Colorado Serum Company, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002116 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
6. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.00) |
a. Manufacturer: |
Colorado Serum Company, Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002263 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
7. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.01) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002264 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
8. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002265 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
9. Encephalomyelitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4865.26) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002267 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
10. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002271 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
11. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002272 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
12. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A0) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002273 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
13. Encephalomyelitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4875.A1) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002274 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
14. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002248 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
15. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002249 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
16. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002250 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
17. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.45) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002251 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
18. Encephalomyelitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4835.46) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002252 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
19. Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 13W5.20) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002115 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
20. Encephalomyelitis-Influenza-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 46W5.21) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002238 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
21. Encephalomyelitis-Rhinopneumonitis Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4844.30) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002253 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
22. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002258 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
23. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002259 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
24. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002260 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
25. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4847.32) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002261 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
26. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002254 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
27. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.24) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002255 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
28. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.32) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002256 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
29. Encephalomyelitis-Rhinopneumonitis-Influenza Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 4845.33) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002257 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
30. Encephalomyelitis-Rhinopneumonitis-Influenza-West Nile Virus Eastern & Western, Killed Virus, Killed Flavivirus Chimera Vaccine-Tetanus Toxoid (USDA: 4855.R2) |
a. Manufacturer: |
Intervet Inc. |
b. Vaccine Ontology ID: |
VO_0002262 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
31. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine (USDA: 14W5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002128 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
32. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.20) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002284 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
33. Encephalomyelitis-West Nile Virus Eastern & Western & Venezuelan, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.23) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002287 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
34. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine (USDA: 14W5.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002127 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
35. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.21) |
a. Manufacturer: |
Boehringer Ingelheim Vetmedica, Inc. |
b. Vaccine Ontology ID: |
VO_0002285 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
36. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus Vaccine-Tetanus Toxoid (USDA: 48W5.22) |
a. Manufacturer: |
Wyeth |
b. Vaccine Ontology ID: |
VO_0002286 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
37. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine (USDA: 14W7.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002129 |
c. Type: |
Live, attenuated vaccine; Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38. Encephalomyelitis-West Nile Virus Eastern & Western, Killed Virus, Live Canarypox Vector Vaccine-Tetanus Toxoid (USDA: 48W9.R0) |
a. Manufacturer: |
Merial, Inc. |
b. Vaccine Ontology ID: |
VO_0002288 |
c. Type: |
Inactivated or "killed" vaccine |
d. Status: |
Licensed |
e. Location Licensed: |
USA |
f. Host Species for Licensed Use: |
Horse |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
39. WEE virus DNA vaccine pVHX-6 encoding 26S |
a. Vaccine Ontology ID: |
VO_0004489 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Mouse |
e. Gene Engineering of
26S |
- Type:
DNA vaccine construction
- Description:
Vector pVAX expressed 26S structural genes of WEEV strain (Nagata et al., 2005).
- Detailed Gene Information: Click here.
|
f. Vector: |
pVAX (Nagata et al., 2005) |
g. Immunization Route |
Intraepidermal immunization |
h.
Mouse Response |
- Vaccine Immune Response Type:
VO_0000286
- Efficacy:
When the DNA vaccine plasmid, pVHX-6, was administered intraepidermally to mice, followed by challenge in a lethal mouse model, the level of protection obtained ranged from 50 to 100% amongst three strains of WEEV (Nagata et al., 2005).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
40. WEEV DNA Vaccine encoding 6K-E1 Protein |
a. Vaccine Ontology ID: |
VO_0011505 |
b. Type: |
DNA vaccine |
c. Status: |
Research |
d. Gene Engineering of
E1 |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
e. Gene Engineering of
6K |
- Type:
DNA vaccine construction
- Description:
- Detailed Gene Information: Click here.
|
f. Vector: |
pVAX (Gauci et al., 2010) |
g. Immunization Route |
Gene Gun |
h.
Mouse Response |
- Host Strain:
BALB/c
- Vaccination Protocol:
Three doses of the DNA vaccine containing 2 μg of plasmid DNA in each vaccine were administered 14 days apart by using a Helios gene gun. Inactivated WEE vaccine was used as a positive control (Gauci et al., 2010).
- Challenge Protocol:
At 14 days after the third vaccination, the mice were challenged intranasally with 1,500 PFU (25 50% lethal doses [LD50s]) of the homologous 71V-1658 strain of WEEV, 1,500 PFU (25 LD50s) of the heterologous Fleming strain, or 1,500 PFU of the heterologous CBA87 strain. The challenged mice were observed for 14 days for survival and the severity of the infection (Gauci et al., 2010).
- Efficacy:
The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
41. WEEV Subunit E2 Protein Vaccine |
a. Vaccine Ontology ID: |
VO_0011506 |
b. Type: |
Subunit vaccine |
c. Status: |
Research |
d. Gene Engineering of
E2 |
- Type:
Recombinant protein preparation
- Description:
- Detailed Gene Information: Click here.
|
e. Adjuvant: |
|
f. Immunization Route |
Intraperitoneal injection (i.p.) |
g.
Mouse Response |
- Host Strain:
BALB/c
- Vaccination Protocol:
mice were immunized intraperitoneally with 50 μg of endotoxin-free E. coli-expressed rE2 antigen emulsified with equal volume of TiterMax Gold adjuvant. Two weeks following primary immunization, mice were immunized with the same amount of antigen emulsified with TiterMax Gold adjuvants. After the 3rd and 4th week, mice were further immunized with the same amount of antigen diluted in PBS. Control mice were immunized with only TiterMax Gold adjuvants (Das et al., 2007).
- Challenge Protocol:
Live virus working stocks were prepared by diluting 1.5 × 10^3 Plaque Forming Units (PFUs) of WEEV in 50 μl HBSS and was administered to the mice intranasally. Sodium pentobarbital (50 mg/kg body weight) was used intraperitoneally to anaesthetize the mice. When the animals were unconscious, they were carefully supported by hand with their nose up and the virus suspension in HBSS gently applied with a micropipette intranasally. The applied volume was then naturally inhaled into the lungs. Infected animals were observed daily, for up to 14 days post-infection (Das et al., 2007).
- Efficacy:
rE2-immunized mice were be partially protected from lethal challenge of WEEV (Das et al., 2007).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
42. Western equine encephalomyelitis virus PE2/E1 mutant vaccine |
a. Product Name: |
WE2130 |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Chicken |
e. Gene Engineering of
PE2 |
- Type:
Gene mutation
- Description:
This PE2/E1 mutant is from Western equine encephalomyelitis virus (Turell et al., 2003).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
E1 |
- Type:
Gene mutation
- Description:
This PE2/E1 mutant is from Western equine encephalomyelitis virus (Turell et al., 2003).
- Detailed Gene Information: Click here.
|
g. Immunization Route |
subcutaneous injection |
h.
Chicken Response |
- Persistence:
WE2130 induced low-level viremia in chickens (Turell et al., 2003).
- Efficacy:
WE2130 protected chickens from challenge with wild type WEE two weeks after initial vaccination (Turell et al., 2003).
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
43. Western equine encephalomyelitis virus PE2/E2 mutant virus |
a. Product Name: |
WE2102 |
b. Type: |
Live, attenuated vaccine |
c. Status: |
Research |
d. Host Species as Laboratory Animal Model: |
Chicken |
e. Gene Engineering of
PE2 |
- Type:
Gene mutation
- Description:
This PE2/E2 mutant is from Western equine encephalomyelitis virus (Turell et al., 2003).
- Detailed Gene Information: Click here.
|
f. Gene Engineering of
E2 |
- Type:
Gene mutation
- Description:
This PE2/E2 mutant is from Western equine encephalomyelitis virus (Turell et al., 2003).
- Detailed Gene Information: Click here.
|
g. Immunization Route |
subcutaneous injection |
h.
Chicken Response |
- Persistence:
WE2102 induced low-level viremia in chickens (Turell et al., 2003).
- Efficacy:
WE2102 protected chickens from challenge with wild type WEE two weeks after initial vaccination (Turell et al., 2003).
|
|
|
|
|
|
|
|
|
IV. References |
1. Das et al., 2007: Das D, Nagata LP, Suresh MR. Immunological evaluation of Escherichia coli expressed E2 protein of Western equine encephalitis virus. Virus research. 2007; 128(1-2); 26-33. [PubMed: 17499379].
2. Gauci et al., 2010: Gauci PJ, Wu JQ, Rayner GA, Barabé ND, Nagata LP, Proll DF. Identification of Western equine encephalitis virus structural proteins that confer protection after DNA vaccination. Clinical and vaccine immunology : CVI. 2010; 17(1); 176-179. [PubMed: 19923571].
3. Nagata et al., 2005: Nagata LP, Hu WG, Masri SA, Rayner GA, Schmaltz FL, Das D, Wu J, Long MC, Chan C, Proll D, Jager S, Jebailey L, Suresh MR, Wong JP. Efficacy of DNA vaccination against western equine encephalitis virus infection. Vaccine. 2005; 23(17-18); 2280-2283. [PubMed: 15755611].
4. Phillips et al., 2014: Phillips AT, Schountz T, Toth AM, Rico AB, Jarvis DL, Powers AM, Olson KE. Liposome-antigen-nucleic acid complexes protect mice from lethal challenge with western and eastern equine encephalitis viruses. Journal of virology. 2014; 88(3); 1771-1780. [PubMed: 24257615].
5. Turell et al., 2003: Turell MJ, O'Guinn ML, Parker MD. Limited potential for mosquito transmission of genetically engineered, live-attenuated western equine encephalitis virus vaccine candidates. The American journal of tropical medicine and hygiene. 2003; 68(2); 218-221. [PubMed: 12641414].
6. Wiki: Western equine encephalomyelitis virus: Western equine encephalomyelitis virus [http://en.wikipedia.org/wiki/Western_equine_encephalitis_virus]
7. Wu et al., 2007: Wu JQ, Barabé ND, Chau D, Wong C, Rayner GR, Hu WG, Nagata LP. Complete protection of mice against a lethal dose challenge of western equine encephalitis virus after immunization with an adenovirus-vectored vaccine. Vaccine. 2007; 25(22); 4368-4375. [PubMed: 17467858].
|