| 1. NCBI Taxonomy ID: |
|
83554 |
|
2. Disease: |
| Respiratory psittacosis, avian chlamydiosis |
|
3. Introduction |
Chlamydophila psittaci is a lethal intracellular bacterial species that causes endemic avian chlamydiosis, epizootic outbreaks in mammals, and respiratory psittacosis in humans. Chlamydophila psittaci is transmitted by inhalation, contact or ingestion among birds and to mammals. Psittacosis in birds and in humans often starts with flu-like symptoms and becomes a life-threatening pneumonia. Many strains remain quiescent in birds until activated under stress. Birds are excellent, highly mobile vectors for the distribution of chlamydial infection because they feed on, and have access to, the detritus of infected animals of all sorts.
Chlamydophila psittaci was previously classified as Chlamydia psittaci. The former 'mammalian' Chlamydia psittaci abortion, feline and Guinea pig strains have been moved to three new species (see: Chlamydophila abortus, Chlamydophila felis, Chlamydophila caviae).
C. psittaci strains are similar in virulence, grow readily in cell culture, have 16S-rRNA genes that differ by <0.8%, and belong to eight known serovars. All should be considered to be readily transmissible to humans (Wiki: Chlamydophila psittaci). |
|
4. Microbial Pathogenesis |
C. psittaci in birds is often systemic and infections can be inapparent, severe, acute or chronic with intermittent shedding. C. psittaci strains in birds infect mucosal epithelial cells and macrophages of the respiratory tract. Septicaemia eventually develops and the bacteria become localized in epithelial cells and macrophages of most organs, conjunctiva, and gastrointestinal tract. It can also be passed in the eggs. Stress will commonly trigger onset of severe symptoms, resulting in rapid deterioration and death. C. psittaci It exists as an elementary body (EB) in between hosts. The EB is not biologically active, but is resistant to environmental stresses and can survive outside a host. The EB travels from an infected bird to the lungs of an uninfected bird or person in small droplets, and is responsible for infection. Once in the lungs, the EB is taken up by cells in a pouch called an endosome by a process called phagocytosis. However, the EB is not destroyed by fusion with lysosomes, as is typical for phagocytosed material. Instead, it transforms into a reticulate body and begins to replicate within the endosome. The reticulate bodies must use some of the host's cellular machinery to complete its replication. The reticulate bodies then convert back to elementary bodies, and are released back into the lung, often after causing the death of the host cell. The EBs are thereafter able to infect new cells, either in the same organism or in a new host (Wiki: Chlamydophila psittaci). |
|
5. Host Ranges and Animal Models |
| C. psittaci serovar A is endemic among psittacine birds and has caused sporadic zoonotic disease in humans, other mammals and tortoises. Serovar B is endemic among pigeons, has been isolated from turkeys, and has also been identified as the cause of abortion in a dairy herd. Serovars C and D are occupational hazards for slaughterhouse workers and for people in contact with birds. Serovar E isolates (known as Cal-10, MP or MN) have been obtained from a variety of avian hosts worldwide and, although they were associated with the 1920s–1930s outbreak in humans, a specific reservoir for serovar E has not been identified. The M56 and WC serovars were isolated during outbreaks in mammals (Wiki: Chlamydophila psittaci) |
|
II. Vaccine Related Pathogen Genes |
|
1. MOMP |
-
Gene Name :
MOMP
-
Sequence Strain (Species/Organism) :
Chlamydophila psittaci 89/1051
-
VO ID :
VO_0010925
-
NCBI Nucleotide GI :
144544
-
NCBI Protein GI :
144545
-
Protein Accession :
AAA17396.1
-
Other Database IDs :
CDD:279628
-
Taxonomy ID :
83554
-
Gene Strand (Orientation) :
?
-
Protein Name :
major outer membrane protein
-
Protein pI :
7.31
-
Protein Weight :
41591.51
-
Protein Length :
471
-
Protein Note :
Chlamydia major outer membrane protein; pfam01308
-
DNA Sequence : Show Sequence
>gi|144544|gb|L04980.1|CHTMOMPXX Chlamydia psittaci major outer membrane protein (MOMP) gene, complete cds
CAATATAAGAAAGCCTTTACACTCTTCTACGAGGGTAATTCCAACTTATTCTAAGTGGCTAAGAAATAAA
AATGTGTACAAAAATCTGATATCTTTTATTAGCAAGTATAAGGAGTTATTTTGAAATCTATGCCTGAAAA
CAGTCTTTTTTCTTATCGTCTTTACTATAATAAGAAAAGTTTGTTATGTTTTCGAATAATGAACTGTATG
TTCATGCTTAAGGCTGTTTTCACTTGCAAGACACTCCTCAAAGCCATTAATTGCCTACAGGATATCTTGT
CTGGCTTTAACTTGGACGTGGTGCCGCCAGAAGAGCAAATTAGAATAGCGAGCACAAAAAGAAAAGATAC
TAAGCATAATCTTTAGAGGTGAGTATGAAAAAACTCTTGAAATCGGCATTATTGTTTGCCGCTACGGGTT
CCGCTCTCTCCTTACAAGCCTTGCCTGTAGGGAACCCAGCTGAACCAAGTTTATTAATCGATGGCACTAT
GTGGGAAGGTGCTTCAGGAGATCCTTGCGATCCTTGCGCTACTTGGTGTGACGCCATTAGCATCCGCGCA
GGATACTACGGAGATTATGTTTTCGATCGTGTATTAAAAGTTGATGTGAATAAAACTTTTAGCGGCATGG
CTGCAACTCCTACGCAGGCTACAGGTAACGCAAGTAATACTAATCAGCCAGAAGCAAATGGCAGACCGAA
CATCGCTTACGGAAGGCATATGCAAGATGCAGAGTGGTTTTCAAATGCAGCCTTCCTAGCCTTAAACATT
TGGGATCGCTTCGACATTTTCTGCACCTTAGGGGCATCCAATGGATACTTCAAATCAAGTTCGGCTGCAT
TCAACTTGGTTGGGTTAATAGGGTTTTCAGCTACCAGCTCAACCTCTACCGAGCTTCCAATGCAACTTCC
TAACGTAGGCATTACCCAAGGTGTTGTGGAATTTTATACAGACACATCATTTTCTTGGAGCGTAGGTGCA
CGTGGAGCTTTATGGGAATGTGGTTGTGCAACTTTAGGAGCTGAGTTCCAATACGCTCAATCTAATCCTA
AGATTGAAGTGCTCAACGTCACTTCAAGCCCAGCACAATTTGTGATTCACAAACCAAGAGGCTATAAAGG
AGCTAGCTCGAATTTTCCTTTACCTATAACGGCTGGAACAACAGAAGCTACAGACACCAAATCAGCTACA
ATTAAATACCATGAATGGCAAGTAGGCCTCGCCCTGTCTTACAGATTGAATATGCTTGTTCCATATATTG
GCGTAAACTGGTCAAGAGCAACTTTTGATGCTGATACTATCCGCATTGCTCAACCTAAATTAAAATCGGA
GATTCTTAACATTACTACATGGAACCCAAGCCTTCTAGGATCAACCACTGCTTTGCCCAATAATGCTGGT
AAGGATGTTCTATCTGATGTCTTGCAAATTGCTTCGATTCAGATCAACAAAATGAAGTCTAGAAAAGCTT
GTGGTGTAGCTGTTGGTGCAACGTTAATCGACGCTGACAAATGGTCAATCACTGGTGAAGCACGCTTAAT
CAATGAAAGAGCTGCTCACATGAATGCTCAATTCAGATTCTAAGGATTTAGTTTATACTATCCTAACTTT
-
Protein Sequence : Show Sequence
>AAA17396.1 major outer membrane protein [Chlamydia psittaci]
MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCATWCDAISIRAGYYGDYVF
DRVLKVDVNKTFSGMAATPTQATGNASNTNQPEANGRPNIAYGRHMQDAEWFSNAAFLALNIWDRFDIFC
TLGASNGYFKSSSAAFNLVGLIGFSATSSTSTELPMQLPNVGITQGVVEFYTDTSFSWSVGARGALWECG
CATLGAEFQYAQSNPKIEVLNVTSSPAQFVIHKPRGYKGASSNFPLPITAGTTEATDTKSATIKYHEWQV
GLALSYRLNMLVPYIGVNWSRATFDADTIRIAQPKLKSEILNITTWNPSLLGSTTALPNNAGKDVLSDVL
QIASIQINKMKSRKACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Plasmid DNA (pcDNA1::MOMP A) expressing the major outer membrane protein (MOMP) of Chlamydophila psittaci genotype A strain 89/1051 has been tested for its ability to induce protective immunity against Cp. psittaci challenge in budgerigars. DNA immunisation significantly reduced clinical signs, macroscopic lesions, pharyngeal and cloacal excretion as well as chlamydial replication, even in the presence of pre-existing serum antibodies, as compared to the placebo-vaccinated controls (Harkinezhad et al., 2009).
|
|
2. MOMP from C. psittaci 6BC |
-
Gene Name :
MOMP from C. psittaci 6BC
-
Sequence Strain (Species/Organism) :
Chlamydia psittaci 6BC
-
VO ID :
VO_0011304
-
NCBI Nucleotide GI :
40568
-
NCBI Protein GI :
40569
-
Protein Accession :
CAA40300.1
-
Other Database IDs :
CDD:279628
GOA:Q46203 InterPro: IPR000604 UniProtKB/UniProt: Q46203
-
Taxonomy ID :
331636
-
Gene Strand (Orientation) :
?
-
Protein Name :
major outer membrane protein
-
Protein pI :
7.26
-
Protein Weight :
41825.82
-
Protein Length :
475
-
Protein Note :
Chlamydia major outer membrane protein; pfam01308
-
DNA Sequence : Show Sequence
>gi|40568|emb|X56980.1| Chlamydia psittaci 6BC gene for major outer membrane protein (MOMP)
TTACACTCTTCTACGAGGGTAATTCCAACTTATTCTAAGTGGCATAAGAAATAAAAATGTGTACAAAAAT
CTGATAGCTCTTTTATTAGCAAGTATAAGGAGTTATTGCTTGAAATCTATGCCTGAAAACAGTCTTTTTT
CTTATCGTCTTTACTATAATAAGAAAAGTTTGTTATGTTTTCGAATAATGAACTGTATGTTCATGCTTAA
GGCTGTTTTCACTTGCAAGACACTCCTCAAAGCCATTAATTGCCTACAGGATATCTTGTCTGGCTTTAAC
TTGGACGTGGTGCCGCCAGAAGAGCAAATTAGAATAGCGAGCACAAAAAGAAAAGATACTAAGCATAATC
TTTAGAGGTGAGTATGAAAAAACTCTTGAAATCGGCATTATTGTTTGCCGCTACGGGTTCCGCTCTCTCC
TTACAAGCCTTGCCTGTAGGGAACCCAGCTGAACCAAGTTTATTAATCGATGGCACTATGTGGGAAGGTG
CTTCAGGAGATCCTTGCGATCCTTGCGCTACTTGGTGTGACGCCATTAGCATCCGCGCAGGATACTACGG
AGATTATGTTTTCGATCGTGTATTAAAAGTTGATGTGAATAAAACTTTTAGCGGCATGGCTGCAACTCCT
ACGCAGGCTACAGGTAACGCAAGTAATACTAATCAGCCAGAAGCAAATGGCAGACCGAACATCGCTTACG
GAAGGCATATGCAAGATGCAGAGTGGTTTTCAAATGCAGCCTTCCTAGCCTTAAACATTTGGGATCGCTT
CGACATTTTCTGCACCTTAGGGGCATCCAATGGATACTTCAAAGCAAGTTCGGCTGCATTCAACTTGGTT
GGGTTAATAGGGTTTTCAGCTGCAAGCTCAATCTCTACCGATCTTCCAATGCAACTTCCTAACGTAGGCA
TTACCCAAGGTGTTGTGGAATTTTATACAGACACATCATTTTCTTGGAGCGTAGGTGCACGTGGAGCTTT
ATGGGAATGTGGTTGTGCAACTTTAGGAGCTGAGTTCCAATACGCTCAATCTAATCCTAAGATTGAAATG
CTCAACGTCACTTCAAGCCCAGCACAATTTGTGATTCACAAACCAAGAGGCTATAAAGGAGCTAGCTCGA
ATTTTCCTTTACCTATAACGGCTGGAACAACAGAAGCTACAGACACCAAATCAGCTACAATTAAATACCA
TGAATGGCAAGTAGGCCTCGCCCTGTCTTACAGATTGAATATGCTTGTTCCATATATTGGCGTAAACTGG
TCAAGAGCAACTTTTGATGCTGATACTATCCGCATTGCTCAACCTAAATTAAAATCGGAGATTCTTAACA
TTACTACATGGAACCCAAGCCTTATAGGATCAACCACTGCTTTGCCCAATAATAGTGGTAAGGATGTTCT
ATCTGATGTCTTGCAAATTGCTTCGATTCAGATCAACAAAATGAAGTCTAGAAAAGCTTGTGGTGTAGCT
GTTGGTGCAACGTTAATCGACGCTGACAAATGGTCAATCACTGGTGAAGCACGCTTAATCAATGAAAGAG
CTGCTCACATGAATGCTCAATTCAGATTCTAAGGATTTAGTTTATACTATCCTAACTTTTTAAACCGCTA
TCAGAACCTGGGAGTCTCCGGGTTCTGATTTTTTAAATACCACCCTTTTC
-
Protein Sequence : Show Sequence
>CAA40300.1 major outer membrane protein [Chlamydia psittaci 6BC]
MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCATWCDAISIRAGYYGDYVF
DRVLKVDVNKTFSGMAATPTQATGNASNTNQPEANGRPNIAYGRHMQDAEWFSNAAFLALNIWDRFDIFC
TLGASNGYFKASSAAFNLVGLIGFSAASSISTDLPMQLPNVGITQGVVEFYTDTSFSWSVGARGALWECG
CATLGAEFQYAQSNPKIEMLNVTSSPAQFVIHKPRGYKGASSNFPLPITAGTTEATDTKSATIKYHEWQV
GLALSYRLNMLVPYIGVNWSRATFDADTIRIAQPKLKSEILNITTWNPSLIGSTTALPNNSGKDVLSDVL
QIASIQINKMKSRKACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
Transgenic rice immunization expressing the Chlamydophila psittaci (Cp. psittaci) antigen (MOMP) fused to the B subunit of Escherichia coli heat-labile enterotoxin (LTB) induced partial protection (53.3%) against a lethal challenge with the highly virulent Cp. psittaci 6BC strain in a BALB/c mouse model (Zhang et al., 2009).
|
|
3. ompA |
-
Gene Name :
ompA
-
Sequence Strain (Species/Organism) :
Chlamydophila psittaci
-
VO ID :
VO_0010924
-
NCBI Protein GI :
94467392
-
Other Database IDs :
CDD:279628
-
Taxonomy ID :
83554
-
Gene Strand (Orientation) :
?
-
Protein pI :
3.92
-
Protein Weight :
7130.24
-
Protein Length :
118
-
Protein Note :
Detected from a 1 year old clinically normal bird that was imported from Singapore
-
Protein Sequence : Show Sequence
>BAE93857.1 ompA, partial [Chlamydia psittaci]
FDIFCTLGASNGYFKSSSAAFNLVGLIGFSATNSTSTDLPMQLPNVGITQGVVEFYTDTSFSWSVGARG
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
The ompA codon was adapted to the codon usage in birds, resulting in pcDNA1/MOMP(opt). Researchers examined the capacity of nebulised or intramuscularly (IM) administered brPEI-pcDNA1/MOMP(opt) to induce a significant protective immune response in SPF turkeys experimentally infected with 10^8 TCID(50) of a virulent Cp. psittaci strain. Vaccinated groups were significantly protected against Cp. psittaci challenge (Verminnen et al., 2010).
- Related Vaccine(s):
C. psittaci DNA vaccine pcDNA1/MOMP
|
|
4. OmpA |
-
Gene Name :
OmpA
-
Sequence Strain (Species/Organism) :
Chlamydophila psittaci
-
NCBI Protein GI :
AIZ00977
-
Other Database IDs :
CDD:279628
-
Taxonomy ID :
83554
-
Protein Name :
major outer membrane protein
-
Protein pI :
4.77
-
Protein Weight :
34555.76
-
Protein Length :
410
-
Protein Note :
amplified with species-specific primers
-
Protein Sequence : Show Sequence
>AIZ00977.1 major outer membrane protein, partial [Chlamydia psittaci]
QALPVGNPAEPSLLIDGTMWEGASGDPCDPCATWCDAISIRAGYYGDYVFDRVLKVDVNKTFSGMAATPT
QATGNASNTNQPEANGRPNIAYGRHMQDAEWFSNAAFLALNIWDRFDIFCTLGASNGYFKSSSAAFNLVG
LIGFSATNSTSTDLPMQLPNVGITQGVVEFYTDTSFSWSVGARGALWECGCATLGAEFQYAQSNPKIEIL
NVTSSPAQFVIHKPRGYKGASSNFPLPITAGTTEATDTKSATIKYHEWQVGLALSYRLNMLVPYIGVNWS
RATFDADTIRIAQPKLKSEILNITTWNPSLLGSTTALPNNSGKDVLSDVLQIA
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
(Zhang et al., 2013)
|
| III. Vaccine Information |
 |
|
 |
|
|
|
|
1. C. psittaci DNA vaccine pcDNA1/MOMP |
| a. Vaccine Ontology ID: |
| VO_0011426 |
| b. Type: |
| DNA vaccine |
| c. Status: |
| Research |
| d. Antigen |
| C. psittaci ompA |
| e. Gene Engineering of
ompA |
- Type:
DNA vaccine construction
- Description:
To enhance the expression of MOMP in turkey cells, the coding sequence of the ompA gene was adapted and optimised to the codon usage in birds (GenScript Corporation, New Jersey, USA) in order to increase the codon adaptation index (CAI). The CAI was calculated (http://www.evolvingcode.net/codon/cai/cai.php) based on the most frequent codon usage in chickens and turkeys. EGFP was cloned downstream from the codon optimised ompAopt into the EcoRV restriction site of pcDNA1, resulting in the final construct: pcDNA1/MOMPopt–EGFP. Plasmid DNA was propagated in Escherichia coli MC1061/P3, purified using the EndoFree® Plasmid Giga kit (Qiagen, Venlo, The Netherlands) and dissolved in 20 mM Hepes buffer (pH 7.4). Following purification, a PCR reaction on the plasmid was performed with vector associated SP6 and T7 primers to amplify the fusion construct cloned into the multicloning site of pcDNA1(Verminnen et al., 2010).
- Detailed Gene Information: Click here.
|
| f. Vector: |
| pcDNA1 |
| g. Immunization Route |
| Intramuscular injection (i.m.) |
| h.
Turkey Response |
- Host Strain:
SPF
- Vaccination Protocol:
Three groups received a primary DNA inoculation at 1 day of age and one booster inoculation 3 weeks later. Groups 1 and 2 were twice immunised intramuscularly with respectively naked plasmid DNA or brPEI-pcDNA/MOMPopt, while group 3 was vaccinated at both time points through nebulisation of brPEI-pcDNA/MOMPopt. The control group (4) was left unvaccinated (Verminnen et al., 2010).
- Challenge Protocol:
Turkeys were challenged by aerosol infection at the age of 5.5 weeks using the Cirrus™ nebulizer. The challenge infection consisted of 108 TCID50 of Cp. psittaci strain 92/1293 (avian genotype D strain). All turkeys were euthanized at 25 days post-challenge (PC) (Verminnen et al., 2010).
- Efficacy:
The ompA codon was adapted to the codon usage in birds, resulting in pcDNA1/MOMP(opt). Researchers examined the capacity of nebulised or intramuscularly (IM) administered brPEI-pcDNA1/MOMP(opt) to induce a significant protective immune response in SPF turkeys experimentally infected with 10^8 TCID(50) of a virulent Cp. psittaci strain. Vaccinated groups were significantly protected against Cp. psittaci challenge (Verminnen et al., 2010).
|
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
2. Chlamydia Psittaci Killed Chlamydia Vaccine (USDA: 1585.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001786 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Parrot |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
3. Chlamydia Psittaci Modified Live Chlamydia Vaccine (USDA: 1581.20) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001787 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Parrot |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
4. Feline Leukemia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1A69.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001842 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
5. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001847 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
6. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001848 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
7. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001849 |
| c. Type: |
| Live, attenuated vaccine; Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
8. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001850 |
| c. Type: |
| Live, attenuated vaccine; Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
9. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.20) |
| a. Manufacturer: |
| Pfizer, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001851 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
10. Feline Rhinotracheitis-Calici-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16F1.21) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001852 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
11. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001862 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
12. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 16E5.23) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001863 |
| c. Type: |
| Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
13. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Killed Chlamydia Vaccine (USDA: 16E6.20) |
| a. Manufacturer: |
| Wyeth |
| b. Vaccine Ontology ID: |
| VO_0001864 |
| c. Type: |
| Live, attenuated vaccine; Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
14. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.20) |
| a. Manufacturer: |
| Wyeth, Intervet Inc., Pfizer, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001865 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
15. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E1.24) |
| a. Manufacturer: |
| Intervet Inc. |
| b. Vaccine Ontology ID: |
| VO_0001866 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
16. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live Virus, Modified Live Chlamydia Vaccine (USDA: 16E8.20) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001867 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
17. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1619.20) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001868 |
| c. Type: |
| Live, attenuated vaccine; Inactivated or "killed" vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
 |
|
 |
|
|
|
|
18. Feline Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci-Rabies Modified Live Virus and Chlamydia, Canarypox Vector Vaccine (USDA: 1619.R1) |
| a. Manufacturer: |
| Merial, Inc. |
| b. Vaccine Ontology ID: |
| VO_0001869 |
| c. Type: |
| Live, attenuated vaccine |
| d. Status: |
| Licensed |
| e. Location Licensed: |
| USA |
| f. Host Species for Licensed Use: |
| Cat |
|
|
|
 |
|
 |
|
|
| IV. References |
1. Harkinezhad et al., 2009: Harkinezhad T, Schautteet K, Vanrompay D. Protection of budgerigars (Melopsittacus undulatus) against Chlamydophila psittaci challenge by DNA vaccination. Veterinary research. 2009; 40(6); 61. [PubMed: 19640395].
2. Verminnen et al., 2010: Verminnen K, Beeckman DS, Sanders NN, De Smedt S, Vanrompay DC. Vaccination of turkeys against Chlamydophila psittaci through optimised DNA formulation and administration. Vaccine. 2010; 28(18); 3095-3105. [PubMed: 20199760].
3. Wiki: Chlamydophila psittaci: Chlamydophila psittaci [http://en.wikipedia.org/wiki/Chlamydophila_psittaci]
4. Zhang et al., 2009: Zhang X, Yuan Z, Duan Q, Zhu H, Yu H, Wang Q. Mucosal immunity in mice induced by orally administered transgenic rice. Vaccine. 2009; 27(10); 1596-1600. [PubMed: 19146896].
5. Zhang et al., 2013: Zhang XX, Yu H, Wang XH, Li XZ, Zhu YP, Li HX, Luo SJ, Yuan ZG. Protective efficacy against Chlamydophila psittaci by oral immunization based on transgenic rice expressing MOMP in mice. Vaccine. 2013; 31(4); 698-703. [PubMed: 23196208].
|