Yersinia pseudotuberculosis is a Gram-negative bacterium which primarily causes disease in animals; humans occasionally get infected zoonotically, most often through the food-borne route. In animals, Y. pseudotuberculosis can cause tuberculosis-like symptoms, including localized tissue necrosis and granulomas in the spleen, liver, and lymph node. In humans, symptoms are similar to those of infection with Yersinia enterocolitica (fever and right-sided abdominal pain), except that the diarrheal component is often absent, which sometimes makes the resulting condition difficult to diagnose. Y. pseudotuberculosis infections can mimic appendicitis, especially in children and younger adults, and, in rare cases the disease may cause skin complaints (erythema nodosum), joint stiffness and pain (reactive arthritis), or spread of bacteria to the blood (bacteremia) (Wiki: Y. pseudotuberuclosis).
Molecule Role Annotation :
A phoP mutant in Yersinia pseudotuberculosis (Yptb) was attenuated and provided protection against oral challenge with virulent Yptb in mice (Balada-Llasat et al., 2007).
Protein Note :
Porin superfamily. These outer membrane channels share a beta-barrel structure that differ in strand and shear number. Classical (gram-negative) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; cl21487
>YP_068464.1 yopB; Yop targeting protein (plasmid) [Yersinia pseudotuberculosis IP 32953]
MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQE
VTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKI
EENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQ
AAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQ
ISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKA
DMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTV
Molecule Role :
Protective antigen
Molecule Role Annotation :
Complexes of YopB (pYV0055), YopD, and YopE (BDE) secreted by Yersinia pseudotuberculosis were purified by affinity chromatography and used as immunogens to determine if antibodies to the translocon could provide protection against Y. pestis in mice. The YopB protein or a complex of YopB and YopD (BD) was purified and determined by vaccination to be immunogenic in mice. Mice actively vaccinated with BD or passively vaccinated with anti-BD serum were protected against lethal challenge with F1(-) Y. pestis (Ivanov et al., 2008).
Molecule Role Annotation :
A protective epitope in type III effector YopE is a major CD8 T cell antigen during primary infection with Yersinia pseudotuberculosis.(Zhang et al., 2012)
Efficacy:
A phoP mutant provided protection against oral challenge with wild type Yersinia pseudotuberculosis (Balada-Llasat et al., 2007).
IV. References
1. Balada-Llasat et al., 2007: Balada-Llasat JM, Panilaitis B, Kaplan D, Mecsas J. Oral inoculation with Type III secretion mutants of Yersinia pseudotuberculosis provides protection from oral, intraperitoneal, or intranasal challenge with virulent Yersinia. Vaccine. 2007; 25(8); 1526-1533. [PubMed: 17194509].
2. Branger et al., 2009: Branger CG, Torres-Escobar A, Sun W, Perry R, Fetherston J, Roland KL, Curtiss R 3rd. Oral vaccination with LcrV from Yersinia pestis KIM delivered by live attenuated Salmonella enterica serovar Typhimurium elicits a protective immune response against challenge with Yersinia pseudotuberculosis and Yersinia enterocolitica. Vaccine. 2009; 27(39); 5363-5370. [PubMed: 19596407].
3. Daniel et al., 2009: Daniel C, Sebbane F, Poiret S, Goudercourt D, Dewulf J, Mullet C, Simonet M, Pot B. Protection against Yersinia pseudotuberculosis infection conferred by a Lactococcus lactis mucosal delivery vector secreting LcrV. Vaccine. 2009; 27(8); 1141-1144. [PubMed: 19135495].
4. Ivanov et al., 2008: Ivanov MI, Noel BL, Rampersaud R, Mena P, Benach JL, Bliska JB. Vaccination of mice with a Yop translocon complex elicits antibodies that are protective against infection with F1- Yersinia pestis. Infection and immunity. 2008; 76(11); 5181-5190. [PubMed: 18765742].
5. Najdenski et al., 2009: Najdenski H, Golkocheva-Markova E, Kussovski V, Vesselinova A, Garbom S, Wolf-Watz H. Attenuation and preserved immunogenic potential of Yersinia pseudotuberculosis mutant strains evidenced in oral pig model. Zoonoses and public health. 2009; 56(4); 157-168. [PubMed: 18793276].
6. Tsybul'ski? et al., 2011: Tsybul'ski? AV, Popov AM, Sanina NM, Maze?ka AN, Portniagina OIu, Novikova OD, Timchenko NF, Kostetski? ÉIa. [Immunogenic and protective properties of nanosized constructs based on tubular immunostimulating complexes and pore forming protein of Yersinia pseudotuberculosis]. Zhurnal mikrobiologii, epidemiologii, i immunobiologii. 2011; (2); 43-47. [PubMed: 21598614].
8. Zhang and Bliska, 2010: Zhang Y, Bliska JB. YopJ-promoted cytotoxicity and systemic colonization are associated with high levels of murine interleukin-18, gamma interferon, and neutrophils in a live vaccine model of Yersinia pseudotuberculosis infection. Infection and immunity. 2010; 78(5); 2329-2341. [PubMed: 20231414].
9. Zhang et al., 2012: Zhang Y, Mena P, Romanov G, Lin JS, Smiley ST, Bliska JB. A protective epitope in type III effector YopE is a major CD8 T cell antigen during primary infection with Yersinia pseudotuberculosis. Infection and immunity. 2012; 80(1); 206-214. [PubMed: 22064714].
