VIOLIN: Vaccine Investigation and Online Information Network

C protein
Gene Name	C protein
Sequence Strain (Species/Organism)	Tick-borne encephalitis virus
NCBI Protein GI	206570298
Other Database IDs	CDD:110034
Taxonomy ID	11084
Gene Strand (Orientation)	?
Protein Name	capsid protein
Protein Length	35
Protein Note	Flavivirus capsid protein C; pfam01003
Protein Sequence	>gi\|206570298\|gb\|ACI12930.1\| capsid protein [Tick-borne encephalitis virus] MARKAILKGKGGGPPRRVSKETAKKTRQSRVQMPN
Molecule Role	Virmugen
Molecule Role Annotation	A virus with a mutation in protein C is attenuated in mice and induced protection from challenge with wild type TBE virus (Kofler et al., 2002).
Related Vaccines(s)	Tick-borne Encephalitis Virus C protein mutant vaccine
References