>AAC41440.1 heat shock protein [Helicobacter pylori]
MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEI
VLDGVEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKH
Molecule Role
Protective antigen
Molecule Role Annotation
Orogastric immunization of mice with recombinant H. pylori HspA proteins protected 80% of animals from a challenge dose of 10^4 Helicobacter felis bacteria (Ferrero et al., 1995). The highest reduction in bacterial colonization was seen in mice immunized with the fusion protein rHspA-GGT when paired with the mucosal adjuvant LTB. Protection against H. pylori colonization was mediated by a strong systemic and localized humoral immune response (Zhang et al., 2015).
