C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS); cd07250
Protein Sequence
>CAC35134.1 human T-cell reactive protein, partial [Coccidioides immitis]
DICTEFSALKSIVMASPNDIVKMPINEPAKGKKQSQIEEYVDFYNGAGVQHIALRTNNIIDAITNLKARG
TEFIKVPETYYEDMKIRLKRQGLVLDEDFETLKSLDILIDFDENGYLLQLFTKHLMDRPT
Molecule Role
Protective antigen
Molecule Role Annotation
The immunogenicity of a 48-kDa T-cell-reactive protein (TCRP) was investigated. Immunization of BALB/c and C3H/HeN mice with the rTCRP affords a modest but significant level of protection against an intraperitoneal challenge with C. immitis. It is suggested that the rTCRP may be able to contribute to a multicomponent vaccine designed to stimulate CMI response against the parasitic cycle of C. immitis.
