>ACZ56254.1 ricin A chain, partial [Ricinus communis]
GPGPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELS
VTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIEL
GNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRVP
Molecule Role
Protective antigen
Molecule Role Annotation
Vaccination against ricin using either denatured toxin or its modified A chain subunit (RTA) has been successful in experimental animals but both vaccines have potential toxicities. Recombinant (r) RTA has not been evaluated as a vaccine. However, the advantage of such a vaccine is that these potential toxicities can be deleted by appropriate mutations. In this study three mutants were generated and shown that two lack toxicity as compared to the wild type rRTA. These mutants induce protective humoral immune responses in mice (Smallshaw et al., 2002).
