>AAB17724.1 protein with neutralization-sensitive epitopes [Cryptosporidium parvum]
MGCSSSKPETKVAENKSAADANKQRELAEKKAQLAKAVKNPAPISNQAQQKPEEPKKSEPAPNNPPAADA
PAAQAPAAPAEPAPQDKPADAPAAEAPAAEPAAQQDKPADA
Molecule Role
Protective antigen
Molecule Role Annotation
In this study, Cp23 antigen was investigated as a vaccine candidate using the DNA vaccine model in adult interleukin-12 (IL-12) knockout (KO) mice, which are susceptible to C. parvum infection. Cp23-DNA vaccination induced a 50-60% reduction in oocysts shedding, indicating a partial protection against C. parvum infection in IL-12 KO mice (Ehigiator et al., 2007).
