>NP_818941.1 6K protein [Western equine encephalitis virus]
ETFGETLNHLWFNNQPFLWAQLCIPLAALVILFRCFSCCMPFLLVAGVCLGKVDA
Molecule Role
Protective antigen
Molecule Role Annotation
DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).
Note: The 6K protein is part of the 6K-E1 structural protein
