>AAP21105.1 stage-specific S antigen-like protein [Leishmania infantum]
MKIRSVRPLVVLLVCVAAVLALSASAEPHKAAVDAGPLSVDVGPLSVDVGPLSVGPQSVGPLSVGPQSVD
PLSVDVGPLSVGPQSVGPLSVDVGPLSVGPQSVGPLSVGLQAVDVSPVS
Molecule Role
Protective antigen
Molecule Role Annotation
Study results show that a single intraperitoneal administration of the A2-recombinant L. tarentolae strain expressing the Leishmania donovani A2 antigen protects BALB/c mice against L. infantum challenge and that protective immunity is associated with high levels of IFN-gamma production prior and after challenge (Mizbani et al., 2009).
