>AAC54579.1 envelope glycoprotein G1, partial [Sin Nombre orthohantavirus]
FLVVLTTATAGLTRNLYELKIECPHTVGLGQGYVTGSVETTPVLFSQVADLKIESSCNFDLHVPATTTQK
YNQVDWTKKSSTTENTNAGAS
Molecule Role
Protective antigen
Molecule Role Annotation
Study used a deer mouse infection model to test the protective efficacy of genetic vaccine candidates for Sin Nombre (SN) virus that were known to provoke immunological responses in BALB/c mice. Protective epitopes were localized in each of four overlapping cDNA fragments that encoded portions of the SN virus G1 glycoprotein antigen; the nucleocapsid gene also was protective (Bharadwaj et al., 2002).
