>CBW47561.1 NS1 protein [Human respiratory syncytial virus B]
MGCNSLSMIKVRLQNLFDNDEVALLKITCYTDKLILLTNALAKATIHTIKLNGIVFIHVITSSEACPDNN
IVVKSNFTTMPILQNGGYIWELIELTHCSQLNGLMDDNCEIKFSKRLSDSVMTDYMNQISDLLGLDLNP
Molecule Role
Protective antigen
Additional Molecule Role Annotation
(Chatterjee et al., 2017)The NS1 protein (139 amino acids) is encoded by a very abundant mRNA transcribed from the promoter proximal RSV gene. NS1 proteins are important immune antagonists, but there is still more research being done on the role of the proteins in viral pathogenesis.
