>AAA24919.1 17 kDa major membrane protein (TUL4) precursor [Francisella tularensis]
MKKIIKLSLLSLSIAGLASCSTLGLGGSDDAKASAKDTAAAQTATTEQAAAVSKPTAKVSLNKLGQDKIK
ATVYTAYNNNPQGSVRLQWQAPEGSKCHDTSFPITKYAEKNDKTWATVTVKQGNNFCSGKWTANVVYDKE
VIASDSINI
Molecule Role
Protective antigen
Molecule Role Annotation
A 17-kDa lipoprotein, TUL4, of the facultative intracellular bacterium Francisella tularensis is one of several membrane proteins that induce an in vitro response in T cells from F. tularensis-primed humans. When mice were immunized with S. typhimurium chi 4072(pTUL4-15), some animals showed an antibody response and a T-cell response to TUL4. The present study demonstrated that the 17-kDa lipoprotein TUL4 of F. tularensis is involved in a protective immunity to tularemia (Sjöstedt et al., 1992).
