|
|
SodC from B. abortus strain 2308 |
|
Gene Name |
SodC from B. abortus strain 2308 |
|
Sequence Strain (Species/Organism) |
Brucella abortus 2308 |
|
VO ID |
VO_0010856
|
|
NCBI Gene ID |
3827840
|
|
NCBI Protein GI |
489062065
|
|
Locus Tag |
BAB_RS28905 |
|
Genbank Accession |
AM040265 |
|
Protein Accession |
WP_002972093 |
|
3D structure: PDB ID |
2AQM
|
|
Taxonomy ID |
359391
|
|
Chromosome No |
II |
|
Gene Starting Position |
534068 |
|
Gene Ending Position |
534589 |
|
Gene Strand (Orientation) |
+ |
|
Protein Name |
superoxide dismutase [Cu-Zn] |
|
Protein pI |
6.74 |
|
Protein Weight |
16741.77 |
|
Protein Length |
173 |
|
DNA Sequence |
>NC_007624.1:534068-534589 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence, strain 2308
GATGAAGTCCTTATTTATTGCATCGACAATGGTGCTTATGGCTTTTCCGGCTTTCGCAGAAAGCACGACG
GTAAAAATGTATGAGGCGCTGCCGACCGGACCGGGTAAAGAAGTTGGCACCGTGGTCATTTCCGAAGCCC
CGGGCGGGCTGCACTTCAAGGTGAATATGGAAAAGCTGACGCCGGGCTATCATGGCTTTCATGTTCACGA
AAATCCAAGCTGCGCTCCGGGAGAAAAAGACGGCAAGATCGTACCGGCTCTTGCTGCCGGCGGGCATTAT
GATCCGGGTAATACCCATCACCATTTAGGACCTGAAGGTGATGGACATATGGGCGATTTGCCACGCCTGA
GCGCCAATGCTGACGGCAAGGTGAGTGAAACCGTTGTCGCTCCACATCTCAAGAAATTGGCGGAAATCAA
GCAGCGTTCTTTGATGGTCCATGTCGGAGGGGATAATTATTCCGATAAGCCTGAGCCGCTTGGTGGCGGT
GGTGCCCGTTTTGCCTGCGGCGTGATCGAATA
|
|
Protein Sequence |
>WP_002972093.1 MULTISPECIES: superoxide dismutase [Cu-Zn] [Brucella]
MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHE
NPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIK
QRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
|
|
Molecule Role |
Protective antigen |
|
Molecule Role Annotation |
IMMUNOGENICITY: Induces antigen-specific Th1 immune response, as indicated by the specific induction of serum IgG2a, but not IgG1, antibodies and by the secretion of IFN-γ, but not IL-4, by the Cu/Zn SOD-stimulated splenocytes. Has been used for vaccine development (Vemulapalli et al., 2000; He et al., 2002; Onate et al., 2003).
MUTATION: An isogenic sodC mutant constructed from B abortus 2308 by gene replacement exhibited much greater susceptibility to killing by exogenous O(2)(-) than the parental 2308 strain, supporting a role for SodC in protecting this bacterium from O(2)(-) stress. The B abortus sodC mutant was much more sensitive to killing by cultured resident peritoneal macrophages from C57BL6J mice than 2308, and its attenuation in cultured murine macrophages was enhanced when these phagocytes were treated with gamma interferon. The attenuation of the B abortus sodC mutant in both resting and IFN-gamma-activated macrophages was alleviated in the presence of the NADPH oxidase inhibitor apocynin. Consistently, the B abortus sodC mutant also displayed significant attenuation in infected C57BL6J mice compared to the parental strain. These findings suggest that SodC protects B abortus 2308 from the respiratory burst of host macrophages (Gee et al., 2005). |
| Related Vaccines(s) |
B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12
,
B. abortus DNA vaccine pcDNA-SOD
,
B. abortus DNA vaccine pcDNA3-SOD encoding Cu-Zn SOD
,
Recombinant B. abortus RB51SOD
|
| References |
Gee et al., 2005: Gee JM, Valderas MW, Kovach ME, Grippe VK, Robertson GT, Ng WL, Richardson JM, Winkler ME, Roop RM 2nd. The Brucella abortus Cu,Zn superoxide dismutase is required for optimal resistance to oxidative killing by murine macrophages and wild-type virulence in experimentally infected mice. Infection and immunity. 2005 May; 73(5); 2873-80. [PubMed: 15845493].
He et al., 2002: He Y, Vemulapalli R, Schurig GG. Recombinant Ochrobactrum anthropi expressing Brucella abortus Cu,Zn superoxide dismutase protects mice against B. abortus infection only after switching of immune responses to Th1 type. Infection and immunity. 2002 May; 70(5); 2535-43. [PubMed: 11953393].
Onate et al., 2003: Onate AA, Cespedes S, Cabrera A, Rivers R, Gonzalez A, Munoz C, Folch H, Andrews E. A DNA vaccine encoding Cu,Zn superoxide dismutase of Brucella abortus induces protective immunity in BALB/c mice. Infection and immunity. 2003 Sep; 71(9); 4857-61. [PubMed: 12933826].
Vemulapalli et al., 2000: Vemulapalli R, He Y, Cravero S, Sriranganathan N, Boyle SM, Schurig GG. Overexpression of protective antigen as a novel approach to enhance vaccine efficacy of Brucella abortus strain RB51. Infection and immunity. 2000 Jun; 68(6); 3286-9. [PubMed: 10816475].
|
|
