VIOLIN: Vaccine Investigation and Online Information Network

IgE
Gene Name	IgE
Sequence Strain (Species/Organism)	Mus musculus
NCBI Protein GI	295790201
Other Database IDs	CDD:209398
Taxonomy ID	10090
Gene Strand (Orientation)	?
Protein Name	immunoglobulin epsilon heavy chain variable region
Protein Length	94
Protein Note	CD19+, CD138-, IgE (CDR-H1 - FR-H4) genotype: wildtype
Protein Sequence	>gi\|295790201\|gb\|ADG28954.1\| immunoglobulin epsilon heavy chain variable region [Mus musculus] GFTFSSYGMSWIRQTPDKRLEWVATISSVGTYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYY CARPELDYGMDYWGQGTSVTVSSA
Molecule Role	Vaximmutor
Related Vaccines(s)	Tetanus Toxoid with Calcium Phosphate
References