VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Porcine circovirus 2

Table of Contents
  1. Protective Antigens
    1. cap
    2. ORF2
1. cap
  • Gene Name : cap
  • Sequence Strain (Species/Organism) : Porcine circovirus 2
  • NCBI Protein GI : AAF35305
  • Other Database IDs : CDD:280582
  • Taxonomy ID : 85708
  • Protein Name : putative capsid protein
  • Protein pI : 11.29
  • Protein Weight : 26699.34
  • Protein Length : 297
  • Protein Note : Cap
  • Protein Sequence : Show Sequence
    >AAF35305.1 putative capsid protein [Porcine circovirus 2]
    MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKRTTVRTPSWAVD
    MMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDP
    YVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFENSIYDQE
    YNIRVTMYVQFREFNFKDPPLNP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Ding et al., 2017)
2. ORF2
  • Gene Name : ORF2
  • Sequence Strain (Species/Organism) : Porcine circovirus type 2
  • VO ID : VO_0011243
  • NCBI Protein GI : 78217439
  • Other Database IDs : CDD:280582
  • Taxonomy ID : 85708
  • Gene Strand (Orientation) : ?
  • Protein Name : ORF2
  • Protein pI : 11.34
  • Protein Weight : 26948.82
  • Protein Length : 278
  • Protein Note : Circovirus capsid protein; pfam02443
  • Protein Sequence : Show Sequence
    >ABB36795.1 ORF2 [Porcine circovirus 2]
    MAYPRRRYRRRRHRPRSHLGQILRRRLWLLHPRHRYRWRRKNGIFNTRLSRTFGYTIKRTTVKTPSWAVD
    MMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDP
    YVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFENSIYDQE
    YNIRVTMYVQFREFNLKDPPLKP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : An open reading frame 2 plasmid (pORF2) and the capsid protein (Cap) of PCV2 were used as DNA and subunit vaccines, respectively. In FCM analysis, although pORF2 and Cap alone showed comparable efficacy in eliciting lymphoproliferative responses and Cap-specific CD4(+) T cells, pORF2 was superior to the Cap protein in triggering CD8(+) T cells. Following virus challenge, real-time PCR and histopathological analysis confirmed that only low viral DNA loads and mild microscopic lesions appeared in pORF2-immunized mice (Shen et al., 2008).
  • Related Vaccine(s): PCV2 DNA Vaccine encoding ORF2 Protein , PrV-PCV2-ORF2
II. References
1. Ding et al., 2017: Ding P, Zhang T, Li Y, Teng M, Sun Y, Liu X, Chai S, Zhou E, Jin Q, Zhang G. Nanoparticle orientationally displayed antigen epitopes improve neutralizing antibody level in a model of porcine circovirus type 2. International journal of nanomedicine. 2017; 12; 5239-5254. [PubMed: 28769561].
2. Shen et al., 2008: Shen HG, Zhou JY, Huang ZY, Guo JQ, Xing G, He JL, Yan Y, Gong LY. Protective immunity against porcine circovirus 2 by vaccination with ORF2-based DNA and subunit vaccines in mice. The Journal of general virology. 2008; 89(Pt 8); 1857-1865. [PubMed: 18632956].