VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (34)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


GP from Sudan ebolavirus

General Information
Protegen ID 453
Sequence Strain (Species/Organism) Sudan ebolavirus
VO ID VO_0010911
Taxonomy ID 186540
Molecule Role Protective antigen
Molecule Role Annotation Cynomolgus macaques were immunized with DNA/rAd5 vaccines expressing ZEBOV (GP) and SEBOV glycoprotein (GP) prior to lethal challenge with BEBOV. Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
Related Vaccines(s) cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species) , CAdVax-ZEBOV/SEBOV , Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens , Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP , Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV
References
Hensley et al., 2010: Hensley LE, Mulangu S, Asiedu C, Johnson J, Honko AN, Stanley D, Fabozzi G, Nichol ST, Ksiazek TG, Rollin PE, Wahl-Jensen V, Bailey M, Jahrling PB, Roederer M, Koup RA, Sullivan NJ. Demonstration of cross-protective vaccine immunity against an emerging pathogenic Ebolavirus Species. PLoS pathogens. 2010; 6(5); e1000904. [PubMed: 20502688].
Gene Information
Gene Name GP from Sudan ebolavirus
NCBI Gene ID 3160774
Genbank Accession AY316199
Locus Tag SEVgp4
Gene Starting Position 5882
Gene Ending Position 8240
DNA Sequence
>NC_006432.1:5882-8240 Sudan ebolavirus isolate Sudan virus/H.sapiens-tc/UGA/2000/Gulu-808892, complete genome
TGATGAAGATTAAGCCTGATGAAGGCCCAACCTTCATCTTTTTACCATAATCTTGTTCTCAGTACCATTT
GATAAGGGTACACTTGCCAATACGCCCCCATCCTAAGGGTCTCGCAATGGGGGGTCTTAGCCTACTCCAA
TTGCCCAGGGACAAATTTCGGAAAAGCTCTTTCTTTGTTTGGGTCATCATCTTATTCCAAAAGGCCTTTT
CCATGCCTTTGGGTGTTGTGACTAACAGCACTTTAGAAGTAACAGAGATTGACCAGCTAGTCTGCAAGGA
TCATCTTGCATCTACTGACCAGCTGAAATCAGTTGGTCTCAACCTCGAGGGGAGCGGAGTATCTACTGAT
ATCCCATCTGCAACAAAGCGTTGGGGCTTCAGATCTGGTGTTCCTCCCAAGGTGGTCAGCTATGAAGCGG
GAGAATGGGCTGAAAATTGCTACAATCTTGAAATAAAGAAGCCGGACGGGAGCGAATGCTTACCCCCACC
GCCAGATGGTGTCAGAGGCTTTCCAAGGTGCCGCTATGTTCACAAAGCCCAAGGAACCGGGCCCTGCCCA
GGTGACTACGCCTTTCACAAGGATGGAGCTTTCTTCCTCTATGACAGGCTGGCTTCAACTGTAATTTACA
GAGGAGTCAATTTTGCTGAGGGGGTAATTGCATTCTTGATATTGGCTAAACCAAAAGAAACGTTCCTTCA
GTCACCCCCCATTCGAGAGGCAGTAAACTACACTGAAAATACATCAAGTTATTATGCCACATCCTACTTG
GAGTATGAAATCGAAAATTTTGGTGCTCAACACTCCACGACCCTTTTCAAAATTGACAATAATACTTTTG
TTCGTCTGGACAGGCCCCACACGCCTCAGTTCCTTTTCCAGCTGAATGATACCATTCACCTTCACCAACA
GTTGAGTAATACAACTGGGAGACTAATTTGGACACTAGATGCTAATATCAATGCTGATATTGGTGAATGG
GCTTTTTGGGAAAATAAAAAAATCTCTCCGAACAACTACGTGGAGAAGAGCTGTCTTTCGAAGCTTTATC
GCTCAACGAGACAGAAGACGATGATGCGGCATCGTCGAGAATTACAAAGGGAAGAATCTCCGACCGGGCC
ACCAGGAAGTATTCGGACCTGGTTCCAAAGAATTCCCCTGGGATGGTTCCATTGCACATACCAGAAGGGG
AAACAACATTGCCGTCTCAGAATTCGACAGAAGGTCGAAGAGTAGGTGTGAACACTCAGGAGACCATTAC
AGAGACAGCTGCAACAATTATAGGCACTAACGGCAACCATATGCAGATCTCCACCATCGGGATAAGACCG
AGCTCCAGCCAAATCCCGAGTTCCTCACCGACCACGGCACCAAGCCCTGAGGCTCAGACCCCCACAACCC
ACACATCAGGTCCATCAGTGATGGCCACCGAGGAACCAACAACACCACCGGGAAGCTCCCCCGGCCCAAC
AACAGAAGCACCCACTCTCACCACCCCAGAAAATATAACAACAGCGGTTAAAACTGTCCTGCCACAGGAG
TCCACAAGCAACGGTCTAATAACTTCAACAGTAACAGGGATTCTTGGGAGTCTTGGGCTTCGAAAACGCA
GCAGAAGACAAACTAACACCAAAGCCACGGGTAAGTGCAATCCCAACTTACACTACTGGACTGCACAAGA
ACAACATAATGCTGCTGGGATTGCCTGGATCCCGTACTTTGGACCGGGTGCGGAAGGCATATACACTGAA
GGCCTGATGCATAACCAAAATGCCTTAGTCTGTGGACTTAGGCAACTTGCAAATGAAACAACTCAAGCTC
TGCAGCTTTTCTTAAGAGCCACAACGGAGCTGCGGACATATACCATACTCAATAGGAAGGCCATAGATTT
CCTTCTGCGACGATGGGGCGGGACATGCAGGATCCTGGGACCAGATTGTTGCATTGAGCCACATGATTGG
ACAAAAAACATCACTGATAAAATCAACCAAATCATCCATGATTTCATCGACAACCCCTTACCTAATCAGG
ATAATGATGATAATTGGTGGACGGGCTGGAGACAGTGGATCCCTGCAGGAATAGGCATTACTGGAATTAT
TATTGCAATTATTGCTCTTCTTTGCGTTTGCAAGCTGCTTTGCTGAATATCAATTTGAATCATCAATTTA
AGCTTGATACATTTCTAGCATTTTAAATTATAAACCGATACTGATACTTGAAAATCAGGCTAATGCCAAG
TTCTGTGCAAAACTTGAAAGTAGGTTTACAAAAATCCTTTGGACTGGAATGCTTTGATACTCTTTCTCAA
TACTATATAAGTTCCTTCCCAAGAATAATATTGATGAAGATTAAGAAAA

Protein Information
Protein Name mRNA
NCBI Protein GI 55770812
Protein Accession YP_138523
Protein pI 6.35
Protein Weight 71813.2
Protein Length 676
Protein Note forms dimers linked by disulfide bonds (parallel orientation); processed by furin to yield SGP and delta peptide
Protein Sequence
>YP_138523.1 spike glycoprotein [Sudan ebolavirus]
MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNL
EGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHK
AQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIREAVNYTENTS
SYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQLNDTIHLHQQLSNTTGRLIWTLDAN
INADIGEWAFWENKKNLSEQLRGEELSFEALSLNETEDDDAASSRITKGRISDRATRKYSDLVPKNSPGM
VPLHIPEGETTLPSQNSTEGRRVGVNTQETITETAATIIGTNGNHMQISTIGIRPSSSQIPSSSPTTAPS
PEAQTPTTHTSGPSVMATEEPTTPPGSSPGPTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGIL
GSLGLRKRSRRQTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQ
LANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDF
IDNPLPNQDNDDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC

Vaxign Prediction
Localization(Probability)
(Prob.=0)
Adhesin Probability 0.448
Trans-membrane Helices 1
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope