VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Mycoplasma gallisepticum

Table of Contents
  1. Protective Antigens
    1. gapA
    2. TM-1
1. gapA
  • Gene Name : gapA
  • Sequence Strain (Species/Organism) : Mycoplasma gallisepticum
  • NCBI Protein GI : AAS65542
  • Other Database IDs : CDD:332876
  • Taxonomy ID : 2096
  • Protein Name : GapA
  • Protein pI : 5.07
  • Protein Weight : 11427.9
  • Protein Length : 159
  • Protein Note : Mycoplasma adhesin P1; cl28055
  • Protein Sequence : Show Sequence
    >AAS65542.1 GapA, partial [Mycoplasma gallisepticum]
    PNRITNPLMNRDNVIGQGAFISRNDIPSSFFENKINDIVTTEADGKEVLDSKYINSIYRYTPPQNNPDIR
    LRLLVIDRSRATNDFIKLLPQVLVDGEYVAVPQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wijesurendra et al., 2017)
2. TM-1
  • Gene Name : TM-1
  • Sequence Strain (Species/Organism) : Mycoplasma gallisepticum
  • VO ID : VO_0011178
  • NCBI Protein GI : 7249262
  • Other Database IDs : CDD:283372
  • Taxonomy ID : 2096
  • Gene Strand (Orientation) : ?
  • Protein Name : TM-1
  • Protein pI : 8.38
  • Protein Weight : 29230.13
  • Protein Length : 329
  • Protein Note : Mycoplasma haemagglutinin; pfam05692
  • Protein Sequence : Show Sequence
    >AAB28343.2 TM-1, partial [Mycoplasma gallisepticum]
    MNKKRIILKTISLLGTTSFLSIGISSCMSITKKDANPNNGQTQLQAARMELTDLINAKARTLASLQDYAK
    IEASLSSAYSEAETVNNNLNATLEQLKMAKTNLESAINQANTDKTTFDNEHPNLVEAYKALKTTLEQRAT
    NLEGLASTAYNQIRNNLVDLYNNASSLITKTLDPLNGGMLLDSNEITTVNRNINNTLSTINEQKTNADAL
    SNSFIKKVIQNNEQSFVGTFTNANVQPSNYSFVAFSADVTPVNYKYARRTVWNGDEPSSRI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : An antiserum raised in chicken against the TM-1 polypeptide, which was produced by recombinant Escherichia coli cells and purified by column chromatography, inhibited growth of M.g. cells in vitro. Moreover, chickens immunized with this 29 kDa polypeptide (TM-1) were partially protected from a challenge with virulent M.g (Saito et al., 1993).
  • Related Vaccine(s): M. gallisepticum TM-1 Protein Subunit Vaccine
II. References
1. Saito et al., 1993: Saito S, Fujisawa A, Ohkawa S, Nishimura N, Abe T, Kodama K, Kamogawa K, Aoyama S, Iritani Y, Hayashi Y. Cloning and DNA sequence of a 29 kilodalton polypeptide gene of Mycoplasma gallisepticum as a possible protective antigen. Vaccine. 1993; 11(10); 1061-1066. [PubMed: 8212828].
2. Wijesurendra et al., 2017: Wijesurendra DS, Kanci A, Tivendale KA, Devlin JM, Wawegama NK, Bacci B, Noormohammadi AH, Markham PF, Browning GF. Immune responses to vaccination and infection with Mycoplasma gallisepticum in turkeys. Avian pathology : journal of the W.V.P.A. 2017; 46(5); 464-473. [PubMed: 28345962].