VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


gapA

General Information
Protegen ID 3904
Sequence Strain (Species/Organism) Mycoplasma gallisepticum
Taxonomy ID 2096
Other Database IDs CDD:332876
Molecule Role Protective antigen
Molecule Role Annotation (Wijesurendra et al., 2017)
References
Wijesurendra et al., 2017: Wijesurendra DS, Kanci A, Tivendale KA, Devlin JM, Wawegama NK, Bacci B, Noormohammadi AH, Markham PF, Browning GF. Immune responses to vaccination and infection with Mycoplasma gallisepticum in turkeys. Avian pathology : journal of the W.V.P.A. 2017; 46(5); 464-473. [PubMed: 28345962].
Gene Information
Gene Name gapA
Protein Information
Protein Name GapA
NCBI Protein GI AAS65542
Protein pI 5.07
Protein Weight 11427.9
Protein Length 159
Protein Note Mycoplasma adhesin P1; cl28055
Protein Sequence
>AAS65542.1 GapA, partial [Mycoplasma gallisepticum]
PNRITNPLMNRDNVIGQGAFISRNDIPSSFFENKINDIVTTEADGKEVLDSKYINSIYRYTPPQNNPDIR
LRLLVIDRSRATNDFIKLLPQVLVDGEYVAVPQ

Epitope Information
IEDB Linear Epitope