|
|
Corynebacterium diphtheriae |
| Table of Contents |
- Protective Antigens
- tox
|
| I. Vaccine Related Protective Antigens |
|
1. tox
|
-
Gene Name :
tox
-
Sequence Strain (Species/Organism) :
Corynebacterium diphtheriae
-
VO ID :
VO_0011287
-
NCBI Protein GI :
38199106
-
Other Database IDs :
CDD:280859
CDD:238651 CDD:280860 CDD:279642 GOA:Q6NK15 InterPro: IPR000512 InterPro: IPR022404 InterPro: IPR022405 InterPro: IPR022406 UniProtKB/TrEMBL: Q6NK15
-
Taxonomy ID :
1717
-
Gene Strand (Orientation) :
?
-
Protein Name :
Diphtheria toxin precursor
-
Protein pI :
6.37
-
Protein Weight :
56772.07
-
Protein Length :
638
-
Protein Note :
biotype gravis
-
Protein Sequence : Show Sequence
>CAE48728.1 Diphtheria toxin precursor [Corynebacterium diphtheriae]
MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGN
YDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLM
EQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQA
CAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTAL
EHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNT
EEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYA
VSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGRKIRMRCRAID
GDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS
-
Molecule Role :
Protective antigen
-
Molecule Role Annotation :
In 1923, it was discovered that treatment with formalin eliminated the toxicity of diphtheria toxin (DT) without destroying its immunogenicity. Formalinâ€treated DT, now called diphtheria toxoid, rapidly became the preferred vaccine against diphtheria, and diphtheria toxoid (usually in combined vaccines, such as diphtheriaâ€tetanus toxoids–pertussis vaccine [DTP] or diphtheriaâ€tetanus toxoids–acellular pertussis vaccine [DTaP] for children and tetanusâ€diphtheria toxoids vaccine for adults [Td]) is still used throughout the world for active immunization against diphtheria (Holmes, 2000).
|
| II. References |
1. Holmes, 2000: Holmes RK. Biology and molecular epidemiology of diphtheria toxin and the tox gene. The Journal of infectious diseases. 2000; 181 Suppl 1; S156-167. [PubMed: 10657208].
|
|