VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


tox

General Information
Protegen ID 750
Sequence Strain (Species/Organism) Corynebacterium diphtheriae
VO ID VO_0011287
Taxonomy ID 1717
Other Database IDs CDD:280859
CDD:238651
CDD:280860
CDD:279642
GOA:Q6NK15
InterPro: IPR000512
InterPro: IPR022404
InterPro: IPR022405
InterPro: IPR022406
UniProtKB/TrEMBL: Q6NK15
Molecule Role Protective antigen
Molecule Role Annotation In 1923, it was discovered that treatment with formalin eliminated the toxicity of diphtheria toxin (DT) without destroying its immunogenicity. Formalin‐treated DT, now called diphtheria toxoid, rapidly became the preferred vaccine against diphtheria, and diphtheria toxoid (usually in combined vaccines, such as diphtheria‐tetanus toxoids–pertussis vaccine [DTP] or diphtheria‐tetanus toxoids–acellular pertussis vaccine [DTaP] for children and tetanus‐diphtheria toxoids vaccine for adults [Td]) is still used throughout the world for active immunization against diphtheria (Holmes, 2000).
References
Holmes, 2000: Holmes RK. Biology and molecular epidemiology of diphtheria toxin and the tox gene. The Journal of infectious diseases. 2000; 181 Suppl 1; S156-167. [PubMed: 10657208].
Gene Information
Gene Name tox
Protein Information
Protein Name Diphtheria toxin precursor
NCBI Protein GI 38199106
Protein pI 6.37
Protein Weight 56772.07
Protein Length 638
Protein Note biotype gravis
Protein Sequence
>CAE48728.1 Diphtheria toxin precursor [Corynebacterium diphtheriae]
MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGN
YDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLM
EQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQA
CAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTAL
EHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNT
EEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYA
VSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGRKIRMRCRAID
GDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS

Epitope Information
IEDB Linear Epitope