VIOLIN: Vaccine Investigation and Online Information Network

Bovine viral diarrhea virus 2

Table of Contents

Protective Antigens
1. E2

I. Vaccine Related Protective Antigens

1. E2

Gene Name : E2
Sequence Strain (Species/Organism) : Bovine viral diarrhea virus 2 TC Shinozaki NCP/92
NCBI Protein GI : 49614538
Other Database IDs : CDD:292945
Taxonomy ID : 54315
Gene Strand (Orientation) : ?
Protein Name : structural glycoprotein E2
Protein pI : 7.92
Protein Weight : 15011.76
Protein Length : 223
Protein Note : synonym: Bovine viral diarrhea virus genotype 2;
synonym: Bovine viral diarrhea virus-2

Protein Sequence : Show Sequence

>BAD27019.1 structural glycoprotein E2, partial [Bovine viral diarrhea virus 2]
CTLANQDTLGTTVIRTYRRTTPFQRRKWCAYEKIIGEDIHECILGGNWTCIIGDHSKLKDGPIKKSKWCG
YDFSSPEGLPHYPIGKCMLSNESGYRYVDDTSCDRGGVAIVPTGTVKCRIGNVTVQVIATNKDLGPMPCS

Molecule Role : Protective antigen
Related Vaccine(s): BVDV DNA vaccine encoding E2

II. References