E2 |
| General Information |
| Protegen ID |
1679 |
|
Sequence Strain (Species/Organism) |
Bovine viral diarrhea virus 2 TC Shinozaki NCP/92 |
|
Taxonomy ID |
54315
|
|
Other Database IDs |
CDD:292945 |
|
Molecule Role |
Protective antigen |
| Related Vaccines(s) |
BVDV DNA vaccine encoding E2
|
| References |
|
| Gene Information |
|
Gene Name |
E2 |
| Protein Information |
|
Protein Name |
structural glycoprotein E2 |
|
NCBI Protein GI |
49614538
|
|
Protein pI |
7.92 |
|
Protein Weight |
15011.76 |
|
Protein Length |
223 |
|
Protein Note |
synonym: Bovine viral diarrhea virus genotype 2; synonym: Bovine viral diarrhea virus-2 |
|
Protein Sequence |
>BAD27019.1 structural glycoprotein E2, partial [Bovine viral diarrhea virus 2]
CTLANQDTLGTTVIRTYRRTTPFQRRKWCAYEKIIGEDIHECILGGNWTCIIGDHSKLKDGPIKKSKWCG
YDFSSPEGLPHYPIGKCMLSNESGYRYVDDTSCDRGGVAIVPTGTVKCRIGNVTVQVIATNKDLGPMPCS
|
| Epitope Information |
| IEDB Linear Epitope |
|
| IEDB ID |
Epitope |
MHC restriction |
Starting position |
Ending position |
| IEDB ID |
Epitope |
Starting position |
Ending position |
|
|
|
CTLANQDTLGTTVIRTYRRTTPFQRRKWCAYEKIIGEDIHECILGGNWTCIIGDHSKLKDGPIKKSKWCGYDFSSPEGLPHYPIGKCMLSNESGYRYVDDTSCDRGGVAIVPTGTVKCRIGNVTVQVIATNKDLGPMPCS
|