VIOLIN: Vaccine Investigation and Online Information Network

Sindbis virus

Table of Contents

Protective Antigens
1. E2

I. Vaccine Related Protective Antigens

1. E2

Gene Name : E2
Sequence Strain (Species/Organism) : Sindbis virus
NCBI Protein GI : 20257395
Other Database IDs : CDD:279311
Taxonomy ID : 11034
Gene Strand (Orientation) : ?
Protein Name : polyprotein
Protein pI : 8.76
Protein Weight : 14816.73
Protein Length : 189
Protein Note : Alphavirus E2 glycoprotein; pfam00943

Protein Sequence : Show Sequence

>AAM15875.1 polyprotein, partial [Sindbis virus]
KPPSGKNITYECKCGDYKTATVSVRTEIAGCTAIKQCVAYKSDQTKWVFNSPDLIRHADHTAQGKLHLPF
KPTLSTCLVPLAHEPTVTHGFKHISLHLDTDHPTLLTTRRLGEKPEPTSEWISGKTVRNFTVDRDGL

Molecule Role : Protective antigen
Related Vaccine(s): Sindbis virus DNA vaccine encoding E2

II. References